• Gene id: 27230

Gene Summary

• Gene Symbol: SERP1   Gene   UCSC   Ensembl
• Aliases: RAMP4
• Gene name: stress associated endoplasmic reticulum protein 1
• Alternate names: stress-associated endoplasmic reticulum protein 1, ribosome associated membrane protein 4, ribosome-attached membrane protein 4,
• Gene location: 3q25.1 (150546495: 150541997)     Exons: 3     NC_000003.12
• OMIM: 617674

Protein Summary

• Protein general information: Q9Y6X1  
  • Name: Stress associated endoplasmic reticulum protein 1 (Ribosome attached membrane protein 4)
  • Length: 66  
  • Mass: 7374
• Sequence:

  MVAKQRIRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIFQIIQSIRMGM

• Structural information:
  • Interpro: IPR010580  
  • STRING: ENSP00000420076
• Other Databases: GeneCards:  SERP1  Malacards:  SERP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030968	endoplasmic reticulum unfolded protein response	IBA	biological process
GO:0006486	protein glycosylation	IBA	biological process
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0007009	plasma membrane organization	TAS	biological process
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0005840	ribosome	TAS	cellular component
GO:0006464	cellular protein modification process	TAS	biological process
GO:0006486	protein glycosylation	TAS	biological process
GO:0036498	IRE1-mediated unfolded protein response	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046622	positive regulation of organ growth	IEA	biological process
GO:0032024	positive regulation of insulin secretion	IEA	biological process
GO:0010259	multicellular organism aging	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process
GO:0060124	positive regulation of growth hormone secretion	IEA	biological process
GO:0048644	muscle organ morphogenesis	IEA	biological process
GO:0045727	positive regulation of translation	IEA	biological process
GO:0030968	endoplasmic reticulum unfolded protein response	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0006006	glucose metabolic process	IEA	biological process
GO:0001501	skeletal system development	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray