• Gene id: 27229

Gene Summary

• Gene Symbol: TUBGCP4   Gene   UCSC   Ensembl
• Aliases: 76P, GCP-4, GCP4, Grip76, MCCRP3
• Gene name: tubulin gamma complex associated protein 4
• Alternate names: gamma-tubulin complex component 4, gamma tubulin ring complex protein (76p gene), gamma-ring complex protein 76 kDa,
• Gene location: 15q15.3 (43371072: 43409770)     Exons: 19     NC_000015.10
• Gene summary(Entrez): This gene encodes a component of the gamma-tubulin ring complex, which is required for microtubule nucleation. In mammalian cells, the protein localizes to centrosomes in association with gamma-tubulin. Crystal structure analysis revealed a structure comp
• OMIM: 609610

Protein Summary

• Protein general information: Q9UGJ1  
  • Name: Gamma tubulin complex component 4 (GCP 4) (hGCP4) (Gamma ring complex protein 76 kDa) (h76p) (hGrip76)
  • Length: 667  
  • Mass: 76089
  • Tissue specificity: Ubiquitously expressed.
• Sequence:

  MIHELLLALSGYPGSIFTWNKRSGLQVSQDFPFLHPSETSVLNRLCRLGTDYIRFTEFIEQYTGHVQQQDHHPSQ
  QGQGGLHGIYLRAFCTGLDSVLQPYRQALLDLEQEFLGDPHLSISHVNYFLDQFQLLFPSVMVVVEQIKSQKIHG
  CQILETVYKHSCGGLPPVRSALEKILAVCHGVMYKQLSAWMLHGLLLDQHEEFFIKQGPSSGNVSAQPEEDEEDL
  GIGGLTGKQLRELQDLRLIEEENMLAPSLKQFSLRVEILPSYIPVRVAEKILFVGESVQMFENQNVNLTRKGSIL
  KNQEDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAEHLWKLMVEESDLLGQLKIIKDFYLLGRGELFQAFIDT
  AQHMLKTPPTAVTEHDVNVAFQQSAHKVLLDDDNLLPLLHLTIEYHGKEHKADATQAREGPSRETSPREAPASGW
  AALGLSYKVQWPLHILFTPAVLEKYNVVFKYLLSVRRVQAELQHCWALQMQRKHLKSNQTDAIKWRLRNHMAFLV
  DNLQYYLQVDVLESQFSQLLHQINSTRDFESIRLAHDHFLSNLLAQSFILLKPVFHCLNEILDLCHSFCSLVSQN
  LGPLDERGAAQLSILVKGFSRQSSLLFKILSSVRNHQINSDLAQLLLRLDYNKYYTQAGGTLGSFGM

• Structural information:
  • Interpro: IPR007259  IPR040457  IPR042241  IPR041470  
  • PDB: 3RIP 6V69 6V6S
  • PDBsum: 3RIP 6V69 6V6S
  • DIP: 50536
  • STRING: ENSP00000260383
• Other Databases: GeneCards:  TUBGCP4  Malacards:  TUBGCP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051415	microtubule nucleation by interphase microtubule organizing center	IBA	biological process
GO:0051321	meiotic cell cycle	IBA	biological process
GO:0031122	cytoplasmic microtubule organization	IBA	biological process
GO:0005813	centrosome	IBA	cellular component
GO:0000923	equatorial microtubule organizing center	IBA	cellular component
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0051225	spindle assembly	IBA	biological process
GO:0051011	microtubule minus-end binding	IBA	contributes to
GO:0043015	gamma-tubulin binding	IBA	molecular function
GO:0000930	gamma-tubulin complex	IBA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007020	microtubule nucleation	IEA	biological process
GO:0000226	microtubule cytoskeleton organization	IEA	biological process
GO:0000922	spindle pole	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0043015	gamma-tubulin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0065003	protein-containing complex assembly	NAS	biological process
GO:0005813	centrosome	TAS	cellular component
GO:0015630	microtubule cytoskeleton	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0005200	structural constituent of cytoskeleton	NAS	molecular function
GO:0008274	gamma-tubulin ring complex	NAS	cellular component
GO:0007020	microtubule nucleation	NAS	biological process
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Autosomal recessive microcephaly and chorioretinopathy	KEGG:H01880
Autosomal recessive microcephaly and chorioretinopathy	KEGG:H01880
Male factor infertility	MIK: 29961538
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray