• Gene id: 27199

Gene Summary

• Gene Symbol: OXGR1   Gene   UCSC   Ensembl
• Aliases: GPR80, GPR99, P2RY15, P2Y15, aKGR
• Gene name: oxoglutarate receptor 1
• Alternate names: 2-oxoglutarate receptor 1, G protein-coupled receptor 80, G-protein coupled receptor 99, P2Y purinoceptor 15, P2Y-like GPCR, P2Y-like nucleotide receptor, alpha-ketoglutarate receptor 1, oxoglutarate (alpha-ketoglutarate) receptor 1, seven transmembrane helix rec,
• Gene location: 13q32.1 (96994729: 96985718)     Exons: 5     NC_000013.11
• Gene summary(Entrez): This gene encodes a G protein-coupled receptor (GPCR) that belongs to the oxoglutarate receptor family within the GPCR superfamily. The encoded protein is activated by the citric acid intermediate, oxoglutarate, as well as several cysteinyl leukotrienes,
• OMIM: 603492

Protein Summary

• Protein general information: Q96P68  
  • Name: 2 oxoglutarate receptor 1 (Alpha ketoglutarate receptor 1) (G protein coupled receptor 80) (G protein coupled receptor 99) (P2Y purinoceptor 15) (P2Y15) (P2Y like GPCR) (P2Y like nucleotide receptor)
  • Length: 337  
  • Mass: 38251
  • Tissue specificity: Detected in kidney and, to a lower extent, in placenta. Not detected in brain tissues including the frontal cortex, caudate putamen, thalamus, hypothalamus, hippocampus or pons.
• Sequence:

  MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIFKMRPWKSSTIIMLNL
  ACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSSILFLTCFSIFRYCVIIHPMSCFSIHKTRCA
  VVACAVVWIISLVAVIPMTFLITSTNRTNRSACLDLTSSDELNTIKWYNLILTATTFCLPLVIVTLCYTTIIHTL
  THGLQTDSCLKQKARRLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLL
  LYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP

• Structural information:
  • Interpro: IPR000276  IPR017452  
  • Prosite: PS50262
  • STRING: ENSP00000298440
• Other Databases: GeneCards:  OXGR1  Malacards:  OXGR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray