• Gene id: 27198

Gene Summary

• Gene Symbol: HCAR1   Gene   UCSC   Ensembl
• Aliases: FKSG80, GPR104, GPR81, HCA1, LACR1, TA-GPCR, TAGPCR
• Gene name: hydroxycarboxylic acid receptor 1
• Alternate names: hydroxycarboxylic acid receptor 1, G protein-coupled receptor 104, G-protein coupled receptor 81, T-cell activation G protein-coupled receptor, hydroxy-carboxylic acid receptor 1, lactate receptor 1,
• Gene location: 12q24.31 (122730843: 122726075)     Exons: 1     NC_000012.12
• Gene summary(Entrez): G protein-coupled receptors (GPCRs, or GPRs), such as GPR81, contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.[supplied by OMIM, Feb 2005]
• OMIM: 606923

Protein Summary

• Protein general information: Q9BXC0  
  • Name: Hydroxycarboxylic acid receptor 1 (G protein coupled receptor 104) (G protein coupled receptor 81)
  • Length: 346  
  • Mass: 39295
  • Tissue specificity: Expressed abundantly in brown and white fat. It also detectable at lower levels in liver, kidney, skeletal muscle, brain and pituitary. Not detected in frontal, temporal and occipital lobes of the cortex, basal forebrain, caudate nucle
• Sequence:

  MYNGSCCRIEGDTISQVMPPLLIVAFVLGALGNGVALCGFCFHMKTWKPSTVYLFNLAVADFLLMICLPFRTDYY
  LRRRHWAFGDIPCRVGLFTLAMNRAGSIVFLTVVAADRYFKVVHPHHAVNTISTRVAAGIVCTLWALVILGTVYL
  LLENHLCVQETAVSCESFIMESANGWHDIMFQLEFFMPLGIILFCSFKIVWSLRRRQQLARQARMKKATRFIMVV
  AIVFITCYLPSVSARLYFLWTVPSSACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPK
  QPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR028016  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000389255
• Other Databases: GeneCards:  HCAR1  Malacards:  HCAR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04024	cAMP signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq