• Gene id: 2719

Gene Summary

• Gene Symbol: GPC3   Gene   UCSC   Ensembl
• Aliases: DGSX, GTR2-2, MXR7, OCI-5, SDYS, SGB, SGBS, SGBS1
• Gene name: glypican 3
• Alternate names: glypican-3, glypican proteoglycan 3, heparan sulphate proteoglycan, intestinal protein OCI-5, secreted glypican-3,
• Gene location: Xq26.2 (133985615: 133535744)     Exons: 11     NC_000023.11
• Gene summary(Entrez): Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protei
• OMIM: 600029

Protein Summary

• Protein general information: P51654  
  • Name: Glypican 3 (GTR2 2) (Intestinal protein OCI 5) (MXR7) [Cleaved into: Glypican 3 alpha subunit; Glypican 3 beta subunit]
  • Length: 580  
  • Mass: 65563
  • Tissue specificity: Highly expressed in lung, liver and kidney. {ECO
• Sequence:

  MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSR
  KMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFT
  DVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQV
  TRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYI
  LSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLKV
  AHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHEL
  KMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAE
  LAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH

• Structural information:
  • Interpro: IPR001863  IPR015501  IPR019803  
  • Prosite: PS01207
  • DIP: 61509
  • STRING: ENSP00000377836
• Other Databases: GeneCards:  GPC3  Malacards:  GPC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IBA	cellular component
GO:0016477	cell migration	IBA	biological process
GO:0046658	anchored component of plasma membrane	IBA	cellular component
GO:1905475	regulation of protein localization to membrane	IBA	biological process
GO:0009986	cell surface	IBA	cellular component
GO:0090263	positive regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0060422	peptidyl-dipeptidase inhibitor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031226	intrinsic component of plasma membrane	TAS	cellular component
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0009966	regulation of signal transduction	IEA	biological process
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006024	glycosaminoglycan biosynthetic process	TAS	biological process
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0006027	glycosaminoglycan catabolic process	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0001658	branching involved in ureteric bud morphogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0009948	anterior/posterior axis specification	IEA	biological process
GO:0030282	bone mineralization	IEA	biological process
GO:0030316	osteoclast differentiation	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0035116	embryonic hindlimb morphogenesis	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0045879	negative regulation of smoothened signaling pathway	IEA	biological process
GO:0045880	positive regulation of smoothened signaling pathway	IEA	biological process
GO:0045926	negative regulation of growth	IEA	biological process
GO:0046326	positive regulation of glucose import	IEA	biological process
GO:0072138	mesenchymal cell proliferation involved in ureteric bud development	IEA	biological process
GO:0072180	mesonephric duct morphogenesis	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:2000096	positive regulation of Wnt signaling pathway, planar cell polarity pathway	IEA	biological process
GO:0001822	kidney development	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0010171	body morphogenesis	IEA	biological process
GO:0030513	positive regulation of BMP signaling pathway	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	IEA	biological process
GO:0045807	positive regulation of endocytosis	IEA	biological process
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0050680	negative regulation of epithelial cell proliferation	IEA	biological process
GO:0060976	coronary vasculature development	IEA	biological process
GO:0072111	cell proliferation involved in kidney development	IEA	biological process
GO:0072203	cell proliferation involved in metanephros development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:2000050	regulation of non-canonical Wnt signaling pathway	IDA	biological process
GO:0060828	regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0060976	coronary vasculature development	ISS	biological process
GO:0042074	cell migration involved in gastrulation	ISS	biological process
GO:0046658	anchored component of plasma membrane	ISS	cellular component
GO:0045879	negative regulation of smoothened signaling pathway	ISS	biological process
GO:0045807	positive regulation of endocytosis	ISS	biological process
GO:0045732	positive regulation of protein catabolic process	ISS	biological process
GO:0072111	cell proliferation involved in kidney development	ISS	biological process
GO:0072138	mesenchymal cell proliferation involved in ureteric bud development	ISS	biological process
GO:0072180	mesonephric duct morphogenesis	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05205	Proteoglycans in cancer

Diseases

Associated diseases	References
Heparan sulfate proteoglycan gene defects	KEGG:H00493
Simpson-Golabi-Behmel syndrome	KEGG:H01215
Heparan sulfate proteoglycan gene defects	KEGG:H00493
Simpson-Golabi-Behmel syndrome	KEGG:H01215
hepatocellular carcinoma	PMID:19496787
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881