• Gene id: 27189

Gene Summary

• Gene Symbol: IL17C   Gene   UCSC   Ensembl
• Aliases: CX2, IL-17C
• Gene name: interleukin 17C
• Alternate names: interleukin-17C, cytokine CX2,
• Gene location: 16q24.2 (88638571: 88640467)     Exons: 3     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is a T cell-derived cytokine that shares the sequence similarity with IL17. This cytokine was reported to stimulate the release of tumor necrosis factor alpha and interleukin 1 beta from a monocytic cell line. The expressi
• OMIM: 604628

Protein Summary

• Protein general information: Q9P0M4  
  • Name: Interleukin 17C (IL 17C) (Cytokine CX2)
  • Length: 197  
  • Mass: 21765
• Sequence:

  MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASH
  RGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVR
  LLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV

• Structural information:
  • Interpro: IPR029034  IPR020440  IPR010345  
  • STRING: ENSP00000244241
• Other Databases: GeneCards:  IL17C  Malacards:  IL17C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0005125	cytokine activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0005125	cytokine activity	TAS	molecular function
GO:0006954	inflammatory response	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0007267	cell-cell signaling	TAS	biological process
GO:0097400	interleukin-17-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04657	IL-17 signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)