• Gene id: 27180

Gene Summary

• Gene Symbol: SIGLEC9   Gene   UCSC   Ensembl
• Aliases: CD329, CDw329, FOAP-9, OBBP-LIKE, siglec-9
• Gene name: sialic acid binding Ig like lectin 9
• Alternate names: sialic acid-binding Ig-like lectin 9, protein FOAP-9,
• Gene location: 19q13.41 (51124879: 51140479)     Exons: 12     NC_000019.10
• OMIM: 142976

Protein Summary

• Protein general information: Q9Y336  
  • Name: Sialic acid binding Ig like lectin 9 (Siglec 9) (CDw329) (Protein FOAP 9) (CD antigen CD329)
  • Length: 463  
  • Mass: 50082
  • Tissue specificity: Expressed by peripheral blood leukocytes (neutrophils and monocytes but not eosinophils). Found in liver, fetal liver, bone marrow, placenta, spleen and in lower levels in skeletal muscle, fetal brain, stomach, lung, thymus, prostate,
• Sequence:

  MLLLLLPLLWGRERAEGQTSKLLTMQSSVTVQEGLCVHVPCSFSYPSHGWIYPGPVVHGYWFREGANTDQDAPVA
  TNNPARAVWEETRDRFHLLGDPHTKNCTLSIRDARRSDAGRYFFRMEKGSIKWNYKHHRLSVNVTALTHRPNILI
  PGTLESGCPQNLTCSVPWACEQGTPPMISWIGTSVSPLDPSTTRSSVLTLIPQPQDHGTSLTCQVTFPGASVTTN
  KTVHLNVSYPPQNLTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSNPPARLSLSWRGLTLCPSQPS
  NPGVLELPWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATALVFLSFCVIFVVVRSCRK
  KSARPAAGVGDTGIEDANAVRGSASQGPLTEPWAEDSPPDQPPPASARSSVGEGELQYASLSFQMVKPWDSRGQE
  ATDTEYSEIKIHR

• Structural information:
  • Protein Domains: (20..14-)
    (/note="Ig-like-V-type)
    (146..22-)
    1 (/note="Ig-like-C2-type)
    (236..33-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000413861
• Other Databases: GeneCards:  SIGLEC9  Malacards:  SIGLEC9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0007155	cell adhesion	IBA	biological process
GO:0033691	sialic acid binding	IBA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0030246	carbohydrate binding	NAS	molecular function
GO:0007166	cell surface receptor signaling pathway	NAS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881