• Gene id: 27173

Gene Summary

• Gene Symbol: SLC39A1   Gene   UCSC   Ensembl
• Aliases: ZIP1, ZIRTL
• Gene name: solute carrier family 39 member 1
• Alternate names: zinc transporter ZIP1, solute carrier family 39 (zinc transporter), member 1, solute carrier family 39 (zinc transporter), member 3, zrt- and Irt-like protein 1,
• Gene location: 1q21.3 (153968183: 153959098)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the zinc-iron permease family. The encoded protein is localized to the cell membrane and acts as a zinc uptake transporter. This gene has been linked to prostate cancer, breast cancer, and Alzheimer's disease. Alternative spl
• OMIM: 611690

Protein Summary

• Protein general information: Q9NY26  
  • Name: Zinc transporter ZIP1 (Solute carrier family 39 member 1) (Zinc iron regulated transporter like) (Zrt and Irt like protein 1) (ZIP 1) (hZIP1)
  • Length: 324  
  • Mass: 34250
  • Tissue specificity: Ubiquitous. Expressed in most adult and fetal tissues including the epidermis. {ECO
• Sequence:

  MGPWGEPELLVWRPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRRPGANHEGSASRQKALSLVSCF
  AGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGFFLVLVMEQITLAYKEQSGPSPLEETRALLG
  TVNGGPQHWHDGPGVPQASGAPATPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSL
  SLRLLQSHLRAQVVAGCGILFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSE
  QRILKVILLLAGFALLTGLLFIQI

• Structural information:
  • Interpro: IPR003689  
  • STRING: ENSP00000357612
• Other Databases: GeneCards:  SLC39A1  Malacards:  SLC39A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071577	zinc ion transmembrane transport	IBA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0030001	metal ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046873	metal ion transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006829	zinc ion transport	IEA	biological process
GO:0022890	inorganic cation transmembrane transporter activity	TAS	molecular function
GO:0016020	membrane	TAS	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0006812	cation transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005385	zinc ion transmembrane transporter activity	IEA	molecular function
GO:0048701	embryonic cranial skeleton morphogenesis	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0006829	zinc ion transport	IEA	biological process
GO:0060173	limb development	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0071577	zinc ion transmembrane transport	IMP	biological process
GO:0071577	zinc ion transmembrane transport	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881