• Gene id: 27166

Gene Summary

• Gene Symbol: PRELID1   Gene   UCSC   Ensembl
• Aliases: CGI-106, PRELI, PX19, SBBI12
• Gene name: PRELI domain containing 1
• Alternate names: PRELI domain-containing protein 1, mitochondrial, 25 kDa protein of relevant evolutionary and lymphoid interest, px19-like protein,
• Gene location: 5q35.3 (177303798: 177306948)     Exons: 5     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the late embryogenesis abundant motif-containing protein family. The encoded protein is localized to mitochondria and may function as a cytoprotectant by regulating cell death and differentiation. Alternative splicing results
• OMIM: 605733

Protein Summary

• Protein general information: Q9Y255  
  • Name: PRELI domain containing protein 1, mitochondrial (25 kDa protein of relevant evolutionary and lymphoid interest) (Px19 like protein)
  • Length: 219  
  • Mass: 25181
  • Tissue specificity: Highly expressed in fetal liver; less expressed in fetal brain, lung, and kidney. At the adult stage, expression is drastically reduced in the liver but highly expressed in the spleen, brain, lung, lymph nodes and peripheral blood leuk
• Sequence:

  MVKYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLTKTNRMPRWAERLFPANVA
  HSVYVLEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDNSGWTEIRREAWVSSSLFGVSRAVQEFGLAR
  FKSNVTKTMKGFEYILAKLQGEAPSKTLVETAKEAKEKAKETALAATEKAKDLASKAATKKQQQQQQFV

• Structural information:
  • Protein Domains: (36..17-)
    (/note="PRELI/MSF1-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00158"-)
  • Interpro: IPR006797  IPR037365  
  • Prosite: PS50904
  • PDB: 6I3V 6I3Y
  • PDBsum: 6I3V 6I3Y
  • STRING: ENSP00000302114
• Other Databases: GeneCards:  PRELID1  Malacards:  PRELID1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005758	mitochondrial intermembrane space	IBA	cellular component
GO:0015914	phospholipid transport	IBA	biological process
GO:0090201	negative regulation of release of cytochrome c from mitochondria	IDA	biological process
GO:0045580	regulation of T cell differentiation	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0010950	positive regulation of endopeptidase activity	IDA	biological process
GO:0010917	negative regulation of mitochondrial membrane potential	IDA	biological process
GO:2001140	positive regulation of phospholipid transport	IDA	biological process
GO:1901857	positive regulation of cellular respiration	IDA	biological process
GO:1901857	positive regulation of cellular respiration	IDA	biological process
GO:0097035	regulation of membrane lipid distribution	IDA	biological process
GO:0070234	positive regulation of T cell apoptotic process	IDA	biological process
GO:0051881	regulation of mitochondrial membrane potential	IDA	biological process
GO:0005758	mitochondrial intermembrane space	IDA	cellular component
GO:1990050	phosphatidic acid transfer activity	IMP	contributes to
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006869	lipid transport	IEA	biological process
GO:0006955	immune response	TAS	biological process
GO:0007275	multicellular organism development	TAS	biological process
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0005758	mitochondrial intermembrane space	TAS	cellular component
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0120009	intermembrane lipid transfer	IEA	biological process
GO:0005739	mitochondrion	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881