• Gene id: 27163

Gene Summary

• Gene Symbol: NAAA   Gene   UCSC   Ensembl
• Aliases: ASAHL, PLT
• Gene name: N-acylethanolamine acid amidase
• Alternate names: N-acylethanolamine-hydrolyzing acid amidase, ASAH-like protein, acid ceramidase-like protein,
• Gene location: 4q21.1 (75941012: 75910654)     Exons: 14     NC_000004.12
• Gene summary(Entrez): This gene encodes an N-acylethanolamine-hydrolyzing enzyme which is highly similar to acid ceramidase. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• OMIM: 601664

Protein Summary

• Protein general information: Q02083  
  • Name: N acylethanolamine hydrolyzing acid amidase (EC 3.5.1.60) (Acid ceramidase like protein) (N acylsphingosine amidohydrolase like) (ASAH like protein) [Cleaved into: N acylethanolamine hydrolyzing acid amidase subunit alpha; N acylethanolamine hydrolyzing a
  • Length: 359  
  • Mass: 40066
  • Tissue specificity: Expressed in numerous tissues, with highest levels in liver and kidney, followed by pancreas. {ECO
• Sequence:

  MRTADREARPGLPSLLLLLLAGAGLSAASPPAAPRFNVSLDSVPELRWLPVLRHYDLDLVRAAMAQVIGDRVPKW
  VHVLIGKVVLELERFLPQPFTGEIRGMCDFMNLSLADCLLVNLAYESSVFCTSIVAQDSRGHIYHGRNLDYPFGN
  VLRKLTVDVQFLKNGQIAFTGTTFIGYVGLWTGQSPHKFTVSGDERDKGWWWENAIAALFRRHIPVSWLIRATLS
  ESENFEAAVGKLAKTPLIADVYYIVGGTSPREGVVITRNRDGPADIWPLDPLNGAWFRVETNYDHWKPAPKEDDR
  RTSAIKALNATGQANLSLEALFQILSVVPVYNNFTIYTTVMSAGSPDKYMTRIRNPSRK

• Structural information:
  • Interpro: IPR016699  IPR029130  IPR029132  
  • PDB: 6DXW 6DXX
  • PDBsum: 6DXW 6DXX
  • STRING: ENSP00000286733
• Other Databases: GeneCards:  NAAA  Malacards:  NAAA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016810	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds	IBA	molecular function
GO:0005764	lysosome	IDA	cellular component
GO:0019898	extrinsic component of membrane	IDA	cellular component
GO:0006631	fatty acid metabolic process	IDA	biological process
GO:0070291	N-acylethanolamine metabolic process	IDA	biological process
GO:0017064	fatty acid amide hydrolase activity	IDA	molecular function
GO:0017064	fatty acid amide hydrolase activity	IDA	molecular function
GO:0006631	fatty acid metabolic process	IDA	biological process
GO:0070291	N-acylethanolamine metabolic process	IDA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016042	lipid catabolic process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0047412	N-(long-chain-acyl)ethanolamine deacylase activity	IEA	molecular function
GO:0016810	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0007269	neurotransmitter secretion	TAS	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016810	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds	IBA	molecular function
GO:0005764	lysosome	IDA	cellular component
GO:0019898	extrinsic component of membrane	IDA	cellular component
GO:0006631	fatty acid metabolic process	IDA	biological process
GO:0070291	N-acylethanolamine metabolic process	IDA	biological process
GO:0017064	fatty acid amide hydrolase activity	IDA	molecular function
GO:0017064	fatty acid amide hydrolase activity	IDA	molecular function
GO:0006631	fatty acid metabolic process	IDA	biological process
GO:0070291	N-acylethanolamine metabolic process	IDA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016042	lipid catabolic process	IEA	biological process
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0047412	N-(long-chain-acyl)ethanolamine deacylase activity	IEA	molecular function
GO:0016810	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0007269	neurotransmitter secretion	TAS	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0008134	transcription factor binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881