Home
Search

Simple

Advanced

Syndromes

Chromosomal defects

Infertility phenotypes

Highthroughput dataset
Browse

Genes

Proteins

SNPs

References

GO

Diseases

Pathways

Tools

Orthologs

SNPs

Motif scan

STRING

CDART
BLAST

BLASTN

BLASTP
Analysis

Panther

Function

GO

Pathways

Diseases
  Help
Statistics
   About Us

Search Result


Gene id 27161
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary
Gene Symbol AGO2   Gene   UCSC   Ensembl
Aliases CASC7, EIF2C2, LINC00980, PPD, Q10
Gene name argonaute RISC catalytic component 2
Alternate names protein argonaute-2, PAZ Piwi domain protein, argonaute 2, RISC catalytic component, cancer susceptibility candidate 7, cancer susceptibility candidate 7 (non-protein coding), eukaryotic translation initiation factor 2C, 2, long intergenic non-protein coding RN,
Gene location 8q24.3 (140642405: 140520155)     Exons: 22     NC_000008.11
Gene summary(Entrez) This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-me
OMIM 606291

Protein Summary
Protein general information Q9UKV8  

Name: Protein argonaute 2 (Argonaute2) (hAgo2) (EC 3.1.26.n2) (Argonaute RISC catalytic component 2) (Eukaryotic translation initiation factor 2C 2) (eIF 2C 2) (eIF2C 2) (PAZ Piwi domain protein) (PPD) (Protein slicer)

Length: 859  Mass: 97208

Sequence MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRVNREIV
EHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGR
LPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFY
KAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQQES
GQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTSTMIRATARSAPDR
QEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKV
WAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGK
TPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTH
PPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQ
FQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYL
CSHAGIQGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSA
EGSHTSGQSNGRDHQALAKAVQVHQDTLRTMYFA
Structural information
Protein Domains
 (235..34-)
(/note="PAZ-)
(/evidence="ECO:0000255|HAMAP-Rule:MF_03031-)
(517..81-)
(/note="Piwi-)
(/evidence="ECO:0000255|HAMAP-Rule:MF_03031"-)
Interpro:  IPR028602  IPR014811  IPR032472  IPR032473  IPR032474  
IPR003100  IPR036085  IPR003165  IPR012337  IPR036397  
Prosite:   PS50821 PS50822

PDB:  		 3LUC 3LUD 3LUG 3LUH 3LUJ 3LUK 3QX8 3QX9 4F3T 4OLA 4OLB 4W5N 4W5O 4W5Q 4W5R 4W5T 4Z4C 4Z4D 4Z4E 4Z4F 4Z4G 4Z4H 4Z4I 5JS1 5JS2 5KI6 5T7B 5WEA 6CBD 6MDZ 6MFN 6MFR 6N4O 6NIT 6RA4
PDBsum:   3LUC 3LUD 3LUG 3LUH 3LUJ 3LUK 3QX8 3QX9 4F3T 4OLA 4OLB 4W5N 4W5O 4W5Q 4W5R 4W5T 4Z4C 4Z4D 4Z4E 4Z4F 4Z4G 4Z4H 4Z4I 5JS1 5JS2 5KI6 5T7B 5WEA 6CBD 6MDZ 6MFN 6MFR 6N4O 6NIT 6RA4

DIP:  
29194
MINT:  
STRING:   ENSP00000220592
Other Databases GeneCards:  AGO2  Malacards:  AGO2

Gene ontology

Expand All | Collapse All
GO accessionTerm nameEvidence codeGo category
GO:0005634 nucleus
 IDA cellular component
GO:0035198 miRNA binding
 IPI molecular function
GO:0035198 miRNA binding
 IPI molecular function
GO:0042985 negative regulation of am
yloid precursor protein b
iosynthetic process
 ISS biological process
GO:0016442 RISC complex
 IGI cellular component
GO:0016442 RISC complex
 IGI cellular component
GO:0016442 RISC complex
 IPI cellular component
GO:0098808 mRNA cap binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:1905618 positive regulation of mi
RNA mediated inhibition o
f translation
 IDA biological process
GO:0045947 negative regulation of tr
anslational initiation
 IDA biological process
GO:1990904 ribonucleoprotein complex
 IDA cellular component
GO:0000932 P-body
 IDA cellular component
GO:0070551 endoribonuclease activity
, cleaving siRNA-paired m
RNA
 IDA molecular function
GO:0035278 miRNA mediated inhibition
of translation
 IDA biological process
GO:0016442 RISC complex
 IDA cellular component
GO:0070578 RISC-loading complex
 IDA cellular component
GO:0005844 polysome
 IDA cellular component
GO:0000932 P-body
 IDA cellular component
GO:0016442 RISC complex
 IDA cellular component
GO:0070578 RISC-loading complex
 IDA cellular component
GO:1900153 positive regulation of nu
clear-transcribed mRNA ca
tabolic process, deadenyl
ation-dependent decay
 ISS biological process
GO:0060213 positive regulation of nu
clear-transcribed mRNA po
ly(A) tail shortening
 ISS biological process
GO:0031047 gene silencing by RNA
 ISS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0003676 nucleic acid binding
 IEA molecular function
GO:0006355 regulation of transcripti
on, DNA-templated
 IEA biological process
GO:0016442 RISC complex
 IEA cellular component
GO:0031047 gene silencing by RNA
 IEA biological process
GO:0070551 endoribonuclease activity
, cleaving siRNA-paired m
RNA
 IEA molecular function
GO:0016787 hydrolase activity
 IEA molecular function
GO:0004519 endonuclease activity
 IEA molecular function
GO:0006417 regulation of translation
 IEA biological process
GO:0046872 metal ion binding
 IEA molecular function
GO:0004518 nuclease activity
 IEA molecular function
GO:0003723 RNA binding
 IEA molecular function
GO:0005737 cytoplasm
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0031047 gene silencing by RNA
 IEA biological process
GO:0000932 P-body
 IDA cellular component
GO:0016442 RISC complex
 IDA cellular component
GO:0005737 cytoplasm
 IDA cellular component
GO:0007223 Wnt signaling pathway, ca
lcium modulating pathway
 TAS biological process
GO:0010629 negative regulation of ge
ne expression
 TAS biological process
GO:0060964 regulation of gene silenc
ing by miRNA
 TAS biological process
GO:0004521 endoribonuclease activity
 TAS molecular function
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005654 nucleoplasm
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0005829 cytosol
 TAS cellular component
GO:0010586 miRNA metabolic process
 TAS biological process
GO:0010628 positive regulation of ge
ne expression
 TAS biological process
GO:0030422 production of siRNA invol
ved in RNA interference
 TAS biological process
GO:0035194 post-transcriptional gene
silencing by RNA
 TAS biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:1990904 ribonucleoprotein complex
 IEA cellular component
GO:0035198 miRNA binding
 IEA molecular function
GO:0030425 dendrite
 IEA cellular component
GO:0010628 positive regulation of ge
ne expression
 IEA biological process
GO:0010586 miRNA metabolic process
 IEA biological process
GO:0009791 post-embryonic developmen
t
 IEA biological process
GO:0005829 cytosol
 IEA cellular component
GO:0004521 endoribonuclease activity
 IEA molecular function
GO:0003729 mRNA binding
 IEA molecular function
GO:0000932 P-body
 IEA cellular component
GO:1900153 positive regulation of nu
clear-transcribed mRNA ca
tabolic process, deadenyl
ation-dependent decay
 IEA biological process
GO:0070578 RISC-loading complex
 IEA cellular component
GO:0060213 positive regulation of nu
clear-transcribed mRNA po
ly(A) tail shortening
 IEA biological process
GO:0035279 mRNA cleavage involved in
gene silencing by miRNA
 IEA biological process
GO:0035196 production of miRNAs invo
lved in gene silencing by
miRNA
 IEA biological process
GO:0031054 pre-miRNA processing
 IEA biological process
GO:0031047 gene silencing by RNA
 IEA biological process
GO:0016442 RISC complex
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0003723 RNA binding
 IEA molecular function
GO:0045766 positive regulation of an
giogenesis
 IDA biological process
GO:1901165 positive regulation of tr
ophoblast cell migration
 IMP biological process
GO:0008022 protein C-terminus bindin
g
 IPI molecular function
GO:0035198 miRNA binding
 TAS molecular function
GO:0070578 RISC-loading complex
 IDA cellular component
GO:0090624 endoribonuclease activity
, cleaving miRNA-paired m
RNA
 IMP molecular function
GO:0035196 production of miRNAs invo
lved in gene silencing by
miRNA
 IDA biological process
GO:0035197 siRNA binding
 IDA contributes to
GO:0035198 miRNA binding
 IDA molecular function
GO:0090624 endoribonuclease activity
, cleaving miRNA-paired m
RNA
 IDA molecular function
GO:0004521 endoribonuclease activity
 IDA molecular function
GO:0035198 miRNA binding
 IDA molecular function
GO:0003725 double-stranded RNA bindi
ng
 IDA molecular function
GO:0003727 single-stranded RNA bindi
ng
 IDA molecular function
GO:0070551 endoribonuclease activity
, cleaving siRNA-paired m
RNA
 IDA molecular function
GO:0000993 RNA polymerase II complex
binding
 IDA molecular function
GO:0001046 core promoter sequence-sp
ecific DNA binding
 IMP molecular function
GO:0090625 mRNA cleavage involved in
gene silencing by siRNA
 IMP biological process
GO:0010501 RNA secondary structure u
nwinding
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0070062 extracellular exosome
 IDA cellular component
GO:0031054 pre-miRNA processing
 IDA biological process
GO:0035196 production of miRNAs invo
lved in gene silencing by
miRNA
 IDA biological process
GO:0016442 RISC complex
 IC cellular component
GO:0035279 mRNA cleavage involved in
gene silencing by miRNA
 IDA biological process
GO:0016442 RISC complex
 IDA cellular component
GO:0010501 RNA secondary structure u
nwinding
 IDA biological process
GO:0035087 siRNA loading onto RISC i
nvolved in RNA interferen
ce
 IDA biological process
GO:0016442 RISC complex
 IDA cellular component
GO:0070578 RISC-loading complex
 IDA cellular component
GO:0031054 pre-miRNA processing
 IDA biological process
GO:0035280 miRNA loading onto RISC i
nvolved in gene silencing
by miRNA
 IDA biological process
GO:0035280 miRNA loading onto RISC i
nvolved in gene silencing
by miRNA
 IDA biological process
GO:0070578 RISC-loading complex
 IDA cellular component
GO:0090625 mRNA cleavage involved in
gene silencing by siRNA
 IDA biological process
GO:0005737 cytoplasm
 IDA cellular component
GO:0035087 siRNA loading onto RISC i
nvolved in RNA interferen
ce
 IC biological process
GO:0005634 nucleus
 IC cellular component
GO:0070578 RISC-loading complex
 IDA cellular component
GO:0031054 pre-miRNA processing
 IDA biological process
GO:0045944 positive regulation of tr
anscription by RNA polyme
rase II
 IMP biological process
GO:0000932 P-body
 IEA cellular component
GO:0005634 nucleus
 IEA cellular component
GO:0005654 nucleoplasm
 IDA cellular component
GO:0030054 cell junction
 IDA cellular component
GO:0000340 RNA 7-methylguanosine cap
binding
 IEA molecular function
GO:0035198 miRNA binding
 IEA molecular function
GO:0035197 siRNA binding
 IEA molecular function
GO:0045947 negative regulation of tr
anslational initiation
 IEA biological process
GO:0016891 endoribonuclease activity
, producing 5'-phosphomon
oesters
 IEA molecular function
GO:0031054 pre-miRNA processing
 IEA biological process
GO:0005845 mRNA cap binding complex
 IEA cellular component
GO:0035278 miRNA mediated inhibition
of translation
 IEA biological process
GO:0016442 RISC complex
 IEA cellular component
GO:0035279 mRNA cleavage involved in
gene silencing by miRNA
 IEA biological process
GO:0090502 RNA phosphodiester bond h
ydrolysis, endonucleolyti
c
 IEA biological process
GO:0090502 RNA phosphodiester bond h
ydrolysis, endonucleolyti
c
 IEA biological process
GO:0090502 RNA phosphodiester bond h
ydrolysis, endonucleolyti
c
 IEA biological process
GO:0090502 RNA phosphodiester bond h
ydrolysis, endonucleolyti
c
 IEA biological process
GO:0090502 RNA phosphodiester bond h
ydrolysis, endonucleolyti
c
 IEA biological process
GO:0090502 RNA phosphodiester bond h
ydrolysis, endonucleolyti
c
 IEA biological process
GO:0090502 RNA phosphodiester bond h
ydrolysis, endonucleolyti
c
 IEA biological process
GO:0006413 translational initiation
 IEA biological process
GO:0045947 negative regulation of tr
anslational initiation
 IDA biological process
GO:0000340 RNA 7-methylguanosine cap
binding
 IDA molecular function
GO:0031054 pre-miRNA processing
 IDA biological process
GO:0005845 mRNA cap binding complex
 IDA cellular component
GO:0035197 siRNA binding
 IDA molecular function
GO:0035197 siRNA binding
 IDA contributes to
GO:0035279 mRNA cleavage involved in
gene silencing by miRNA
 IDA biological process
GO:0035278 miRNA mediated inhibition
of translation
 IDA biological process
GO:0016442 RISC complex
 IDA cellular component
GO:0035279 mRNA cleavage involved in
gene silencing by miRNA
 IMP biological process
GO:0035278 miRNA mediated inhibition
of translation
 IMP biological process
GO:0005515 protein binding
 IPI molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0006412 translation
 NAS biological process
GO:0003743 translation initiation fa
ctor activity
 NAS molecular function
GO:0005515 protein binding
 IPI molecular function
GO:0003723 RNA binding
 HDA molecular function
GO:0003723 RNA binding
 HDA molecular function
GO:0016020 membrane
 HDA cellular component

Diseases

Expand All | Collapse All
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 28606200
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All
PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia
19 (6 controls
, 13 cases)
 Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
 Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm
18
 Male infertility GSE26881
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract
28606200 Cryptorchi
dism
Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
 Male infertility MeDIP-Seq
 Show abstract