• Gene id: 27158

Gene Summary

• Gene Symbol: NDOR1   Gene   UCSC   Ensembl
• Aliases: CIAE1, NR1, bA350O14.9
• Gene name: NADPH dependent diflavin oxidoreductase 1
• Alternate names: NADPH-dependent diflavin oxidoreductase 1, NADPH-dependent FMN and FAD-containing oxidoreductase,
• Gene location: 9q34.3 (137205666: 137219360)     Exons: 14     NC_000009.12
• Gene summary(Entrez): This gene encodes an NADPH-dependent diflavin reductase that contains both flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) binding domains. The encoded protein catalyzes the transfer of electrons from NADPH through FAD and FMN cofactors
• OMIM: 606073

Protein Summary

• Protein general information: Q9UHB4  
  • Name: NADPH dependent diflavin oxidoreductase 1 (EC 1.18.1. ) (NADPH dependent FMN and FAD containing oxidoreductase) (Novel reductase 1)
  • Length: 597  
  • Mass: 66763
  • Tissue specificity: Low expression in brain, heart, kidney, pancreas, prostate and skeletal muscle. Highest levels in the placenta. Expressed in cancer cell lines including promyelocytic leukemia, HeLaS3, chronic myelagenous leukemia, lymphoblastic leukem
• Sequence:

  MPSPQLLVLFGSQTGTAQDVSERLGREARRRRLGCRVQALDSYPVVNLINEPLVIFVCATTGQGDPPDNMKNFWR
  FIFRKNLPSTALCQMDFAVLGLGDSSYAKFNFVAKKLHRRLLQLGGSALLPVCLGDDQHELGPDAAVDPWLRDLW
  DRVLGLYPPPPGLTEIPPGVPLPSKFTLLFLQEAPSTGSEGQRVAHPGSQEPPSESKPFLAPMISNQRVTGPSHF
  QDVRLIEFDILGSGISFAAGDVVLIQPSNSAAHVQRFCQVLGLDPDQLFMLQPREPDVSSPTRLPQPCSMRHLVS
  HYLDIASVPRRSFFELLACLSLHELEREKLLEFSSAQGQEELFEYCNRPRRTILEVLCDFPHTAAAIPPDYLLDL
  IPVIRPRAFSIASSLLTHPSRLQILVAVVQFQTRLKEPRRGLCSSWLASLDPGQGPVRVPLWVRPGSLAFPETPD
  TPVIMVGPGTGVAPFRAAIQERVAQGQTGNFLFFGCRWRDQDFYWEAEWQELEKRDCLTLIPAFSREQEQKVYVQ
  HRLRELGSLVWELLDRQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTETWA

• Structural information:
  • Protein Domains: (6..15-)
    (/note="Flavodoxin-like-)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03178-)
    (206..44-)
    (/note="FAD-binding-FR-type)
    (/evidence="ECO:0000255|HAMAP-Rule:MF_03178"-)
  • Interpro: IPR003097  IPR017927  IPR001094  IPR008254  IPR001709   IPR029039  IPR039261  IPR023173  IPR028879  IPR001433  IPR017938  
  • Prosite: PS51384 PS50902
  • PDB: 4H2D
  • PDBsum: 4H2D
  • STRING: ENSP00000360576
• Other Databases: GeneCards:  NDOR1  Malacards:  NDOR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003958	NADPH-hemoprotein reductase activity	IBA	molecular function
GO:0016491	oxidoreductase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0010181	FMN binding	IBA	molecular function
GO:0016709	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	IBA	molecular function
GO:0050660	flavin adenine dinucleotide binding	IBA	molecular function
GO:0036245	cellular response to menadione	IDA	biological process
GO:0010181	FMN binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0003958	NADPH-hemoprotein reductase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0045111	intermediate filament cytoskeleton	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0010181	FMN binding	IEA	molecular function
GO:0050660	flavin adenine dinucleotide binding	IEA	molecular function
GO:0050661	NADP binding	IEA	molecular function
GO:0016226	iron-sulfur cluster assembly	IEA	biological process
GO:0016651	oxidoreductase activity, acting on NAD(P)H	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0050661	NADP binding	IDA	molecular function
GO:0050660	flavin adenine dinucleotide binding	IDA	molecular function
GO:0010181	FMN binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0016491	oxidoreductase activity	IDA	molecular function
GO:0016491	oxidoreductase activity	IDA	molecular function
GO:0016491	oxidoreductase activity	IDA	molecular function
GO:0050661	NADP binding	IDA	molecular function
GO:0008219	cell death	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq