About Us

Search Result


Gene id 27141
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol CIDEB   Gene   UCSC   Ensembl
Gene name cell death inducing DFFA like effector b
Alternate names cell death activator CIDE-B,
Gene location 14q12 (24311434: 24305095)     Exons: 8     NC_000014.9

Protein Summary

Protein general information Q9UHD4  

Name: Cell death activator CIDE B (Cell death inducing DFFA like effector B)

Length: 219  Mass: 24678

Tissue specificity: Highly expressed in liver and small intestine and, at lower levels, in colon, kidney and spleen. {ECO

Sequence MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTL
VLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSL
NVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY
Structural information
Protein Domains
(34..11-)
(/note="CIDE-N-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00447"-)
Interpro:  IPR003508  
Prosite:   PS51135

PDB:  
1D4B
PDBsum:   1D4B
STRING:   ENSP00000337731
Other Databases GeneCards:  CIDEB  Malacards:  CIDEB

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0042981 regulation of apoptotic p
rocess
IBA biological process
GO:0006915 apoptotic process
IEA biological process
GO:0006915 apoptotic process
IEA biological process
GO:0008630 intrinsic apoptotic signa
ling pathway in response
to DNA damage
TAS biological process
GO:0005829 cytosol
IDA cellular component
GO:0006915 apoptotic process
IDA biological process
GO:0048471 perinuclear region of cyt
oplasm
IDA cellular component
GO:0090200 positive regulation of re
lease of cytochrome c fro
m mitochondria
IDA biological process
GO:0097202 activation of cysteine-ty
pe endopeptidase activity
IDA biological process
GO:0010942 positive regulation of ce
ll death
IDA biological process
GO:0042802 identical protein binding
IPI molecular function
GO:0042802 identical protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0097194 execution phase of apopto
sis
IEA biological process
GO:0097194 execution phase of apopto
sis
ISS biological process
Associated diseases References
Male factor infertility MIK: 29961538
Spermatogenic defects MIK: 31037746

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
29961538 Male facto
r infertil
ity

318 (128 couple
s presenting wi
th OAT (MF) and
118 maternal a
ge-matched cont
rol (no MF) sub
jects undergoin
g infertility t
reatment, 72 su
rplus cryoprese
rved blastocyst
s)
Male infertility RNA-seq
Show abstract
31037746 Spermatoge
nic defect
s

28 men with az
oospermia
Male infertility Microarray
Show abstract