• Gene id: 27131

Gene Summary

• Gene Symbol: SNX5   Gene   UCSC   Ensembl
• Gene name: sorting nexin 5
• Alternate names: sorting nexin-5,
• Gene location: 20p11.23 (17968793: 17941599)     Exons: 14     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein functions in endosomal sorting, the phosphoi
• OMIM: 605937

Protein Summary

• Protein general information: Q9Y5X3  
  • Name: Sorting nexin 5
  • Length: 404  
  • Mass: 46816
• Sequence:

  MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWL
  HDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTVSSHEVFLQRL
  SSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKD
  SCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYML
  NIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEELINFKRKRVAAFRKN
  LIEMSELEIKHARNNVSLLQSCIDLFKNN

• Structural information:
  • Protein Domains: (25..17-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147-)
    (202..40-)
    (/note="BAR"-)
  • Interpro: IPR027267  IPR001683  IPR036871  IPR042135  IPR028654   IPR014637  IPR015404  
  • Prosite: PS50195
  • CDD: cd07291
  • PDB: 1SYS 5TGH 5TGI 5TGJ 5WY2 6N5X 6N5Y 6N5Z
  • PDBsum: 1SYS 5TGH 5TGI 5TGJ 5WY2 6N5X 6N5Y 6N5Z
  • STRING: ENSP00000366998
• Other Databases: GeneCards:  SNX5  Malacards:  SNX5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016241	regulation of macroautophagy	NAS	biological process
GO:0030905	retromer, tubulation complex	NAS	cellular component
GO:0042147	retrograde transport, endosome to Golgi	NAS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IMP	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0046628	positive regulation of insulin receptor signaling pathway	IMP	biological process
GO:0005768	endosome	IBA	cellular component
GO:0006907	pinocytosis	IBA	biological process
GO:0034452	dynactin binding	IBA	molecular function
GO:0035091	phosphatidylinositol binding	IBA	molecular function
GO:0042147	retrograde transport, endosome to Golgi	IBA	biological process
GO:0070685	macropinocytic cup	IDA	cellular component
GO:0031901	early endosome membrane	IDA	colocalizes with
GO:0031313	extrinsic component of endosome membrane	IDA	cellular component
GO:0006907	pinocytosis	IDA	biological process
GO:0034452	dynactin binding	IDA	molecular function
GO:0097422	tubular endosome	IDA	cellular component
GO:0035091	phosphatidylinositol binding	IDA	molecular function
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IDA	cellular component
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IDA	cellular component
GO:0030904	retromer complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035091	phosphatidylinositol binding	ISS	molecular function
GO:0042147	retrograde transport, endosome to Golgi	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006907	pinocytosis	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0006897	endocytosis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005903	brush border	IEA	cellular component
GO:0031748	D1 dopamine receptor binding	IEA	molecular function
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0035815	positive regulation of renal sodium excretion	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0007174	epidermal growth factor catabolic process	IEA	biological process
GO:0010314	phosphatidylinositol-5-phosphate binding	IEA	molecular function
GO:0045776	negative regulation of blood pressure	IEA	biological process
GO:0070273	phosphatidylinositol-4-phosphate binding	IEA	molecular function
GO:0080025	phosphatidylinositol-3,5-bisphosphate binding	IEA	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0001891	phagocytic cup	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq