• Gene id: 27129

Gene Summary

• Gene Symbol: HSPB7   Gene   UCSC   Ensembl
• Aliases: cvHSP
• Gene name: heat shock protein family B (small) member 7
• Alternate names: heat shock protein beta-7, cardiovascular heat shock protein, heat shock 27kD protein family, member 7 (cardiovascular), heat shock 27kDa protein family, member 7 (cardiovascular),
• Gene location: 1p36.13 (16019593: 16014027)     Exons: 4     NC_000001.11
• Gene summary(Entrez): This gene encodes a small heat shock family B member that can heterodimerize with similar heat shock proteins. Defects in this gene are associated with advanced heart failure. In addition, the encoded protein may be a tumor suppressor in the p53 pathway,

Protein Summary

• Protein general information: Q9UBY9  
  • Name: Heat shock protein beta 7 (HspB7) (Cardiovascular heat shock protein) (cvHsp)
  • Length: 170  
  • Mass: 18611
  • Tissue specificity: Isoform 1 is highly expressed in adult and fetal heart, skeletal muscle, and at a much lower levels in adipose tissue and in aorta. Undetectable in other tissues. Isoform 2 and isoform 3 are poorly detected in heart.
• Sequence:

  MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHSEPLAFPARPGGAGNI
  KTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIR
  ARRHPHTEHVQQTFRTEIKI

• Structural information:
  • Protein Domains: (62..17-)
    (/note="sHSP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00285"-)
  • Interpro: IPR002068  IPR037885  IPR001436  IPR008978  
  • Prosite: PS01031
  • CDD: cd06479
  • STRING: ENSP00000310111
• Other Databases: GeneCards:  HSPB7  Malacards:  HSPB7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0008022	protein C-terminus binding	TAS	molecular function
GO:0006986	response to unfolded protein	TAS	biological process
GO:0008016	regulation of heart contraction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015030	Cajal body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016235	aggresome	IDA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0007507	heart development	IEA	biological process

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray