• Gene id: 27128

Gene Summary

• Gene Symbol: CYTH4   Gene   UCSC   Ensembl
• Aliases: CYT4, DJ63G5.1, PSCD4, cytohesin-4
• Gene name: cytohesin 4
• Alternate names: cytohesin-4, PH, SEC7 and coiled-coil domain-containing protein 4, pleckstrin homology, Sec7 and coiled/coil domains 4,
• Gene location: 22q13.1 (37282507: 37315340)     Exons: 13     NC_000022.11
• Gene summary(Entrez): This gene encodes a member of the PSCD family of proteins, which have an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains
• OMIM: 606724

Protein Summary

• Protein general information: Q9UIA0  
  • Name: Cytohesin 4 (PH, SEC7 and coiled coil domain containing protein 4)
  • Length: 394  
  • Mass: 45672
  • Tissue specificity: Expressed predominantly in peripheral blood leukocytes. {ECO
• Sequence:

  MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQKEKELCIGRKKFNMD
  PAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDPINLQVLQAFVDCHEFANLNLVQALRQFLWS
  FRLPGEAQKIDRMMEAFATRYCLCNPGVFQSTDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSD
  LPEDQLRNLFDSIKSEPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPR
  GIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSAEERDQWIESIRASIT
  RVPFYDLVSTRKKKIASKQ

• Structural information:
  • Protein Domains: (54..24-)
    (/note="SEC7-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00189-)
    (259..37-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR011993  IPR001849  IPR023394  IPR000904  IPR035999  
  • Prosite: PS50003 PS50190
  • CDD: cd00171
  • STRING: ENSP00000248901
• Other Databases: GeneCards:  CYTH4  Malacards:  CYTH4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005086	ARF guanyl-nucleotide exchange factor activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005086	ARF guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0032012	regulation of ARF protein signal transduction	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa04072	Phospholipase D signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray