• Gene id: 27123

Gene Summary

• Gene Symbol: DKK2   Gene   UCSC   Ensembl
• Aliases: DKK-2
• Gene name: dickkopf WNT signaling pathway inhibitor 2
• Alternate names: dickkopf-related protein 2, dickkopf 2 homolog, dickkopf homolog 2, dickkopf-2, hDkk-2,
• Gene location: 4q25 (107036312: 106921801)     Exons: 4     NC_000004.12
• Gene summary(Entrez): This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. It can act as either an agonist
• OMIM: 615790

Protein Summary

• Protein general information: Q9UBU2  
  • Name: Dickkopf related protein 2 (Dickkopf 2) (Dkk 2) (hDkk 2)
  • Length: 259  
  • Mass: 28447
  • Tissue specificity: Expressed in heart, brain, skeletal muscle and lung.
• Sequence:

  MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQA
  YPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDR
  NHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGL
  EIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI

• Structural information:
  • Interpro: IPR006796  IPR039863  
  • DIP: 59408
  • STRING: ENSP00000285311
• Other Databases: GeneCards:  DKK2  Malacards:  DKK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090090	negative regulation of canonical Wnt signaling pathway	NAS	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	NAS	biological process
GO:0048019	receptor antagonist activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0039706	co-receptor binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005615	extracellular space	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0039706	co-receptor binding	IEA	molecular function
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IDA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq