• Gene id: 27121

Gene Summary

• Gene Symbol: DKK4   Gene   UCSC   Ensembl
• Aliases: DKK-4
• Gene name: dickkopf WNT signaling pathway inhibitor 4
• Alternate names: dickkopf-related protein 4, dickkopf-4, hDkk-4,
• Gene location: 8p11.21 (42391321: 42373193)     Exons: 6     NC_000008.11
• Gene summary(Entrez): This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. Activity of this protein is modu
• OMIM: 601149

SNPs

rs7004637

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000008.11   g.42392929A>G
NC_000008.10   g.42250447A>G|SEQ=[A/G]|GENE=VDAC3
DKK4   27121

Protein Summary

• Protein general information: Q9UBT3  
  • Name: Dickkopf related protein 4 (Dickkopf 4) (Dkk 4) (hDkk 4) [Cleaved into: Dickkopf related protein 4 short form]
  • Length: 224  
  • Mass: 24876
  • Tissue specificity: Expressed in cerebellum, T-cells, esophagus and lung.
• Sequence:

  MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQR
  DAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRTFD
  CGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL

• Structural information:
  • Interpro: IPR006796  IPR039863  IPR023569  
  • PDB: 5O57
  • PDBsum: 5O57
  • STRING: ENSP00000220812
• Other Databases: GeneCards:  DKK4  Malacards:  DKK4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007275	multicellular organism development	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0061170	negative regulation of hair follicle placode formation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	NAS	biological process
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0090090	negative regulation of canonical Wnt signaling pathway	NAS	biological process
GO:0048019	receptor antagonist activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0039706	co-receptor binding	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881