• Gene id: 27115

Gene Summary

• Gene Symbol: PDE7B   Gene   UCSC   Ensembl
• Aliases: bA472E5.1
• Gene name: phosphodiesterase 7B
• Alternate names: cAMP-specific 3',5'-cyclic phosphodiesterase 7B, high-affinity cAMP-specific 3',5'-cyclic phosphodiesterase, rolipram-insensitive phosphodiesterase type 7,
• Gene location: 6q23.3 (135851700: 136195573)     Exons: 13     NC_000006.12
• Gene summary(Entrez): The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways. 3',5'-cyclic nucleotide phosphodiesterases (PDEs) catalyze the hydrolysis of cAMP and cGMP to the corresponding 5'-monophosphates a
• OMIM: 604645

Protein Summary

• Protein general information: Q9NP56  
  • Name: cAMP specific 3',5' cyclic phosphodiesterase 7B (EC 3.1.4.53)
  • Length: 450  
  • Mass: 51835
  • Tissue specificity: Highly expressed in brain. Also expressed in heart, liver, skeletal muscle and pancreas.
• Sequence:

  MSCLMVERCGEILFENPDQNAKCVCMLGDIRLRGQTGVRAERRGSYPFIDFRLLNSTTYSGEIGTKKKVKRLLSF
  QRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGMWDFDIFLFDRLTNGNSLVTLLCHLFNTHGLIHHFKL
  DMVTLHRFLVMVQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFL
  IKTNHHLANLYQNMSVLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN
  KDLRLEDAQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEISPLCNQQKDSIPSIQI
  GFMSYIVEPLFREWAHFTGNSTLSENMLGHLAHNKAQWKSLLPRQHRSRGSSGSGPDHDHAGQGTESEEQEGDSP

• Structural information:
  • Protein Domains: (97..42-)
    (/note="PDEase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01192"-)
  • Interpro: IPR003607  IPR023088  IPR002073  IPR036971  IPR023174  
  • Prosite: PS00126 PS51845
  • CDD: cd00077
  • PDB: 1LXW
  • PDBsum: 1LXW
  • STRING: ENSP00000310661
• Other Databases: GeneCards:  PDE7B  Malacards:  PDE7B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IBA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004114	3',5'-cyclic-nucleotide phosphodiesterase activity	IEA	molecular function
GO:0008081	phosphoric diester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0004115	3',5'-cyclic-AMP phosphodiesterase activity	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0006198	cAMP catabolic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00230	Purine metabolism
hsa05032	Morphine addiction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray