• Gene id: 27112

Gene Summary

• Gene Symbol: FAM155B   Gene   UCSC   Ensembl
• Aliases: CXorf63, TED, TMEM28, bB57D9.1
• Gene name: family with sequence similarity 155 member B
• Alternate names: transmembrane protein FAM155B, bB57D9.1 (TED protein), transmembrane protein 28,
• Gene location: Xq13.1 (69504325: 69532507)     Exons: 5     NC_000023.11
• Gene summary(Entrez): This gene encodes a product belonging to a family of proteins with unknown function. The presence of two transmembrane domains suggests that this protein is a multi-pass membrane protein. [provided by RefSeq, Sep 2011]

Protein Summary

• Protein general information: O75949  
  • Name: Transmembrane protein FAM155B (Protein TED) (Transmembrane protein 28)
  • Length: 472  
  • Mass: 52477
• Sequence:

  MFRGAWMWPGKDAAALTICCCCCCWAPRPSDKPCADSERAQRWRLSLASLLFFTVLLADHLWLCAGARPRARELS
  SAMRPPWGAGRERQPVPPRAVLPLPPPPPGEPSAPPGTCGPRYSNLTKAAPAAGSRPVCGGVPEPTGLDAACTKL
  QSLQRLFEPTTPAPPLRPPDSLSRAPAEFPSAKKNLLKGHFRNFTLSFCDTYTVWDLLLGMDRPDSLDCSLDTLM
  GDLLAVVASPGSGAWEACSNCIEAYQRLDRHAQEKYDEFDLVLHKYLQAEEYSIRSCTKGCKAVYKAWLCSEYFS
  VTQQECQRWVPCKQYCLEVQTRCPFILPDNEEMVYGGLPGFICTGLLDTSPKRLETKCCDVQWVSCEAKKKKFKE
  SEAPKTHQQQFHHSYFHHYHQQYHHYHPHHDPPGRVSNKPALLPVSGGSRLSPSRIRLCVLVLMLLHTVVSFSSN
  QGGGGLGLETLPALEEGLTREE

• Structural information:
  • Interpro: IPR029604  
  • STRING: ENSP00000252338
• Other Databases: GeneCards:  FAM155B  Malacards:  FAM155B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0015275	stretch-activated, cation-selective, calcium channel activity	IBA	contributes to
GO:0098703	calcium ion import across plasma membrane	IBA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)