• Gene id: 27101

Gene Summary

• Gene Symbol: CACYBP   Gene   UCSC   Ensembl
• Aliases: GIG5, PNAS-107, S100A6BP, SIP
• Gene name: calcyclin binding protein
• Alternate names: calcyclin-binding protein, S100A6-binding protein, Siah-interacting protein (SIP), growth-inhibiting gene 5 protein, hCacyBP,
• Gene location: 1q25.1 (174999434: 175012026)     Exons: 17     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and parti
• OMIM: 606186

Protein Summary

• Protein general information: Q9HB71  
  • Name: Calcyclin binding protein (CacyBP) (hCacyBP) (S100A6 binding protein) (Siah interacting protein)
  • Length: 228  
  • Mass: 26210
• Sequence:

  MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITTGYTVKI
  SNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKNLNGKSYSMIVNNLLKPISVEGSSKKVKTDTV
  LILCRKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREKQAKGD
  TEF

• Structural information:
  • Protein Domains: (73..16-)
    (/note="CS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00547-)
    (168..22-)
    (/note="SGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00386"-)
  • Interpro: IPR037201  IPR037893  IPR007052  IPR008978  IPR007699   IPR015120  
  • Prosite: PS51203 PS51048
  • CDD: cd06468
  • PDB: 1X5M 2A25 2A26
  • PDBsum: 1X5M 2A25 2A26
  • STRING: ENSP00000356652
• Other Databases: GeneCards:  CACYBP  Malacards:  CACYBP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0007507	heart development	IBA	biological process
GO:0030877	beta-catenin destruction complex	IDA	cellular component
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015631	tubulin binding	IEA	molecular function
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0044548	S100 protein binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071277	cellular response to calcium ion	IEA	biological process
GO:0060548	negative regulation of cell death	IEA	biological process
GO:0044297	cell body	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0007568	aging	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0060416	response to growth hormone	IEA	biological process
GO:0055007	cardiac muscle cell differentiation	IEA	biological process
GO:0045740	positive regulation of DNA replication	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0019904	protein domain specific binding	IEA	molecular function
GO:0019005	SCF ubiquitin ligase complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005641	nuclear envelope lumen	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
pancreatic cancer	PMID:18765951
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881