• Gene id: 27097

Gene Summary

• Gene Symbol: TAF5L   Gene   UCSC   Ensembl
• Aliases: PAF65B
• Gene name: TATA-box binding protein associated factor 5 like
• Alternate names: TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L, PAF65-beta, PCAF-associated factor 65 beta, TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa,
• Gene location: 1q42.13 (229626121: 229593110)     Exons: 36     NC_000001.11
• Gene summary(Entrez): The product of this gene belongs to the WD-repeat TAF5 family of proteins. This gene encodes a protein that is a component of the PCAF histone acetylase complex. The PCAF histone acetylase complex, which is composed of more than 20 polypeptides some of wh

Protein Summary

• Protein general information: O75529  
  • Name: TAF5 like RNA polymerase II p300/CBP associated factor associated factor 65 kDa subunit 5L (TAF5L) (PCAF associated factor 65 beta) (PAF65 beta)
  • Length: 589  
  • Mass: 66155
• Sequence:

  MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFG
  RLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDIL
  SNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEP
  PDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSK
  KLKSEPHQVDVSRIHLACDILEEEDDEDDNAGTEMKILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFT
  NTVLYQGHAYPVWDLDISPYSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTV
  RLWSAQQGNSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLI
  ASASMDNSVRVWDIRNTYCSAPADGSSSELVGVYTGQMSNVLSVQFMACNLLLVTGITQENQEH

• Structural information:
  • Interpro: IPR020472  IPR037826  IPR007582  IPR037264  IPR015943   IPR001680  IPR019775  IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • CDD: cd08044
  • DIP: 28147
  • STRING: ENSP00000258281
• Other Databases: GeneCards:  TAF5L  Malacards:  TAF5L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005669	transcription factor TFIID complex	IBA	cellular component
GO:1990841	promoter-specific chromatin binding	IBA	molecular function
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0016251	RNA polymerase II general transcription initiation factor activity	IBA	contributes to
GO:0043966	histone H3 acetylation	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:1904672	regulation of somatic stem cell population maintenance	ISS	biological process
GO:0006355	regulation of transcription, DNA-templated	ISS	biological process
GO:0033276	transcription factor TFTC complex	IEA	cellular component
GO:0030914	STAGA complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1904672	regulation of somatic stem cell population maintenance	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0003713	transcription coactivator activity	IDA	molecular function
GO:0033276	transcription factor TFTC complex	IDA	cellular component
GO:0004402	histone acetyltransferase activity	IDA	contributes to
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0030914	STAGA complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)