• Gene id: 27090

Gene Summary

• Gene Symbol: ST6GALNAC4   Gene   UCSC   Ensembl
• Aliases: IV, SIAT3-C, SIAT3C, SIAT7-D, SIAT7D, ST6GALNACIV, ST6GalNAc
• Gene name: ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
• Alternate names: alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase, NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2, 6-sialyltransferase alpha2,6-sialyltransferase, NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransfer,
• Gene location: 9q34.11 (27888708: 28338900)     Exons: 16     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein prefers glycoproteins rather than glycolipids as substrates and shows re
• OMIM: 606378

Protein Summary

• Protein general information: Q9H4F1  
  • Name: Alpha N acetyl neuraminyl 2,3 beta galactosyl 1,3 N acetyl galactosaminide alpha 2,6 sialyltransferase (EC 2.4.99.7) (NeuAc alpha 2,3 Gal beta 1,3 GalNAc alpha 2,6 sialyltransferase) (ST6GalNAc IV) (ST6GalNAcIV) (Sialyltransferase 3C) (SIAT3 C) (Sialyltra
  • Length: 302  
  • Mass: 34201
  • Tissue specificity: Ubiquitous.
• Sequence:

  MKAPGRLVLIILCSVVFSAVYILLCCWAGLPLCLATCLDHHFPTGSRPTVPGPLHFSGYSSVPDGKPLVREPCRS
  CAVVSSSGQMLGSGLGAEIDSAECVFRMNQAPTVGFEADVGQRSTLRVVSHTSVPLLLRNYSHYFQKARDTLYMV
  WGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMILALELC
  EEIVVYGMVSDSYCREKSHPSVPYHYFEKGRLDECQMYLAHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWR
  TE

• Structural information:
  • Interpro: IPR001675  IPR038578  IPR012163  
  • STRING: ENSP00000336733
• Other Databases: GeneCards:  ST6GALNAC4  Malacards:  ST6GALNAC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001574	ganglioside biosynthetic process	IBA	biological process
GO:0097503	sialylation	IBA	biological process
GO:0009311	oligosaccharide metabolic process	IBA	biological process
GO:0008373	sialyltransferase activity	IBA	molecular function
GO:0001665	alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IBA	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0008373	sialyltransferase activity	TAS	molecular function
GO:0006664	glycolipid metabolic process	TAS	biological process
GO:0047290	(alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl-galactosaminide 6-alpha-sialyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0016266	O-glycan processing	TAS	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00604	Glycosphingolipid biosynthesis - ganglio series

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq