• Gene id: 27089

Gene Summary

• Gene Symbol: UQCRQ   Gene   UCSC   Ensembl
• Aliases: MC3DN4, QCR8, QP-C, QPC, UQCR7
• Gene name: ubiquinol-cytochrome c reductase complex III subunit VII
• Alternate names: cytochrome b-c1 complex subunit 8, complex III subunit 8, complex III subunit VIII, low molecular mass ubiquinone-binding protein (9.5kD), ubiquinol-cytochrome c reductase complex 9.5 kDa protein, ubiquinol-cytochrome c reductase complex ubiquinone-binding pro,
• Gene location: 5q31.1 (132866641: 132868846)     Exons: 3     NC_000005.10
• Gene summary(Entrez): This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain. [provided by RefSeq,
• OMIM: 612080

Protein Summary

• Protein general information: O14949  
  • Name: Cytochrome b c1 complex subunit 8 (Complex III subunit 8) (Complex III subunit VIII) (Ubiquinol cytochrome c reductase complex 9.5 kDa protein) (Ubiquinol cytochrome c reductase complex ubiquinone binding protein QP C)
  • Length: 82  
  • Mass: 9906
• Sequence:

  MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNP
  AAYENDK

• Structural information:
  • Interpro: IPR004205  IPR036642  
  • PDB: 5XTE 5XTH 5XTI
  • PDBsum: 5XTE 5XTH 5XTI
  • STRING: ENSP00000367939
• Other Databases: GeneCards:  UQCRQ  Malacards:  UQCRQ

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008121	ubiquinol-cytochrome-c reductase activity	IBA	contributes to
GO:0005750	mitochondrial respiratory chain complex III	IBA	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	IBA	biological process
GO:0008121	ubiquinol-cytochrome-c reductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0070469	respirasome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	TAS	biological process
GO:0021854	hypothalamus development	IEA	biological process
GO:0021794	thalamus development	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0021680	cerebellar Purkinje cell layer development	IEA	biological process
GO:0021548	pons development	IEA	biological process
GO:0021539	subthalamus development	IEA	biological process
GO:0030901	midbrain development	IEA	biological process
GO:0021860	pyramidal neuron development	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa04714	Thermogenesis
hsa00190	Oxidative phosphorylation
hsa04932	Non-alcoholic fatty liver disease
hsa04260	Cardiac muscle contraction

Diseases

Associated diseases	References
Mitochondrial complex III deficiency	KEGG:H02086
Mitochondrial complex III deficiency	KEGG:H02086
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)