• Gene id: 27075

Gene Summary

• Gene Symbol: TSPAN13   Gene   UCSC   Ensembl
• Aliases: NET-6, NET6, TM4SF13
• Gene name: tetraspanin 13
• Alternate names: tetraspanin-13, tetraspan NET-6, transmembrane 4 superfamily member 13, transmembrane 4 superfamily member tetraspan NET-6, tspan-13,
• Gene location: 7p21.1 (173477334: 173488814)     Exons: 5     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate
• OMIM: 613139

Protein Summary

• Protein general information: O95857  
  • Name: Tetraspanin 13 (Tspan 13) (Tetraspan NET 6) (Transmembrane 4 superfamily member 13)
  • Length: 204  
  • Mass: 22147
• Sequence:

  MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIALVGLIGAVKHHQVLL
  FFYMIILLLVFIVQFSVSCACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHS
  CSPCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL

• Structural information:
  • Interpro: IPR000301  IPR018499  
  • STRING: ENSP00000262067
• Other Databases: GeneCards:  TSPAN13  Malacards:  TSPAN13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:1903169	regulation of calcium ion transmembrane transport	IEA	biological process
GO:0005246	calcium channel regulator activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881