• Gene id: 27071

Gene Summary

• Gene Symbol: DAPP1   Gene   UCSC   Ensembl
• Aliases: BAM32
• Gene name: dual adaptor of phosphotyrosine and 3-phosphoinositides 1
• Alternate names: dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide, B-cell adapter molecule of 32 kDa, b lymphocyte adapter protein Bam32, hDAPP1,
• Gene location: 4q23 (99816826: 99872289)     Exons: 13     NC_000004.12
• OMIM: 605768

Protein Summary

• Protein general information: Q9UN19  
  • Name: Dual adapter for phosphotyrosine and 3 phosphotyrosine and 3 phosphoinositide (hDAPP1) (B lymphocyte adapter protein Bam32) (B cell adapter molecule of 32 kDa)
  • Length: 280  
  • Mass: 32194
  • Tissue specificity: Highly expressed in placenta and lung, followed by brain, heart, kidney, liver, pancreas and skeletal muscle. Expressed by B-lymphocytes, but not T-lymphocytes or nonhematopoietic cells. {ECO
• Sequence:

  MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVR
  AKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQT
  GRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERV
  NCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK

• Structural information:
  • Protein Domains: (35..12-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (164..25-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR035843  IPR011993  IPR001849  IPR000980  IPR036860  
  • Prosite: PS50003 PS50001
  • CDD: cd10355
  • PDB: 1FAO 1FB8
  • PDBsum: 1FAO 1FB8
  • STRING: ENSP00000423602
• Other Databases: GeneCards:  DAPP1  Malacards:  DAPP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0043325	phosphatidylinositol-3,4-bisphosphate binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IDA	molecular function
GO:0043325	phosphatidylinositol-3,4-bisphosphate binding	IDA	molecular function
GO:0006470	protein dephosphorylation	NAS	biological process
GO:0005543	phospholipid binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04662	B cell receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881