• Gene id: 27067

Gene Summary

• Gene Symbol: STAU2   Gene   UCSC   Ensembl
• Aliases: 39K2, 39K3
• Gene name: staufen double-stranded RNA binding protein 2
• Alternate names: double-stranded RNA-binding protein Staufen homolog 2, staufen homolog 2, staufen, RNA binding protein, homolog 2,
• Gene location: 8q21.11 (73747707: 73420368)     Exons: 4     NC_000008.11
• Gene summary(Entrez): Staufen homolog 2 is a member of the family of double-stranded RNA (dsRNA)-binding proteins involved in the transport and/or localization of mRNAs to different subcellular compartments and/or organelles. These proteins are characterized by the presence of
• OMIM: 605920

Protein Summary

• Protein general information: Q9NUL3  
  • Name: Double stranded RNA binding protein Staufen homolog 2
  • Length: 570  
  • Mass: 62608
• Sequence:

  MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSKMFSVQLSLGEQTWESEGSSIKKAQQAVANKALTESTL
  PKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHCPVPKIFYVQL
  TVGNNEFFGEGKTRQAARHNAAMKALQALQNEPIPERSPQNGESGKDVDDDKDANKSEISLVFEIALKRNMPVSF
  EVIKESGPPHMKSFVTRVSVGEFSAEGEGNSKKLSKKRAATTVLQELKKLPPLPVVEKPKLFFKKRPKTIVKAGP
  EYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEVATGTGPNKKIAKKNAAEAMLLQLGY
  KASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVYQEMEASRHKVISGTTLGYLSPKDMNQPSSS
  FFSISPTSNSSATIARELLMNGTSSTAEAIGLKGSSPTPPCSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLD
  PIDGAMNIEKGSLEKQAKHLREKADNNQAPPGSIAQDCKKSNSAV

• Structural information:
  • Protein Domains: (8..7-)
    (/note="DRBM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00266-)
    (95..18-)
    (/note="DRBM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00266-)
    (207..27-)
    (/note="DRBM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00266-)
    (-)
  • Interpro: IPR014720  IPR032478  
  • Prosite: PS50137
  • CDD: cd00048
  • STRING: ENSP00000428756
• Other Databases: GeneCards:  STAU2  Malacards:  STAU2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0003725	double-stranded RNA binding	TAS	molecular function
GO:0003725	double-stranded RNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray