• Gene id: 27065

Gene Summary

• Gene Symbol: NSG1   Gene   UCSC   Ensembl
• Aliases: D4S234, D4S234E, NEEP21, P21
• Gene name: neuronal vesicle trafficking associated 1
• Alternate names: neuronal vesicle trafficking-associated protein 1, brain neuron cytoplasmic protein 1, carboxyterminally EE-tagged neuron-enriched endosomal 21 kDa protein, neuron specific gene family member 1, neuron-enriched endosomal protein of 21 kD, neuron-enriched endos,
• Gene location: 4p16.3 (4386255: 4419057)     Exons: 6     NC_000004.12

Protein Summary

• Protein general information: P42857  
  • Name: Neuronal vesicle trafficking associated protein 1 (Neuron enriched endosomal protein of 21 kDa) (Neuron specific protein family member 1)
  • Length: 185  
  • Mass: 20913
• Sequence:

  MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTEYEPDRKKGKARPPQIAEFTVSITE
  GVTERFKVSVLVLFALAFLTCVVFLVVYKVYKYDRACPDGFVLKNTQCIPEGLESYYAEQDSSAREKFYTVINHY
  NLAKQSITRSVSPWMSVLSEEKLSEQETEAAEKSA

• Structural information:
  • Interpro: IPR009431  
  • STRING: ENSP00000388823
• Other Databases: GeneCards:  NSG1  Malacards:  NSG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005768	endosome	IBA	cellular component
GO:0032051	clathrin light chain binding	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016197	endosomal transport	IBA	biological process
GO:0048268	clathrin coat assembly	IBA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0032588	trans-Golgi network membrane	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0005768	endosome	ISS	cellular component
GO:0042982	amyloid precursor protein metabolic process	ISS	biological process
GO:1900271	regulation of long-term synaptic potentiation	ISS	biological process
GO:0099630	postsynaptic neurotransmitter receptor cycle	ISS	biological process
GO:0098814	spontaneous synaptic transmission	ISS	biological process
GO:0055038	recycling endosome membrane	ISS	cellular component
GO:0036477	somatodendritic compartment	ISS	cellular component
GO:0031901	early endosome membrane	ISS	cellular component
GO:0001881	receptor recycling	ISS	biological process
GO:0006915	apoptotic process	IMP	biological process
GO:0005770	late endosome	ISS	cellular component
GO:0099627	neurotransmitter receptor cycle	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007212	dopamine receptor signaling pathway	IEA	biological process
GO:0032051	clathrin light chain binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0048268	clathrin coat assembly	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0042982	amyloid precursor protein metabolic process	IEA	biological process
GO:0016328	lateral plasma membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0001881	receptor recycling	IEA	biological process
GO:1900271	regulation of long-term synaptic potentiation	IEA	biological process
GO:0099630	postsynaptic neurotransmitter receptor cycle	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098814	spontaneous synaptic transmission	IEA	biological process
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0036477	somatodendritic compartment	IEA	cellular component
GO:0032588	trans-Golgi network membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0099627	neurotransmitter receptor cycle	IEA	biological process
GO:0099003	vesicle-mediated transport in synapse	IEA	biological process
GO:0098887	neurotransmitter receptor transport, endosome to postsynaptic membrane	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0098845	postsynaptic endosome	IEA	cellular component
GO:0043202	lysosomal lumen	IEA	cellular component
GO:0016197	endosomal transport	IEA	biological process
GO:0005770	late endosome	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0001921	positive regulation of receptor recycling	IEA	biological process
GO:0031901	early endosome membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0032585	multivesicular body membrane	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0032580	Golgi cisterna membrane	IEA	cellular component
GO:0043202	lysosomal lumen	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray