• Gene id: 27044

Gene Summary

• Gene Symbol: SND1   Gene   UCSC   Ensembl
• Aliases: TDRD11, Tudor-SN, p100
• Gene name: staphylococcal nuclease and tudor domain containing 1
• Alternate names: staphylococcal nuclease domain-containing protein 1, EBNA2 coactivator p100, testis tissue sperm-binding protein Li 82P, tudor domain-containing protein 11,
• Gene location: 7q32.1 (127652144: 128092592)     Exons: 25     NC_000007.14
• Gene summary(Entrez): This gene encodes a transcriptional co-activator that interacts with the acidic domain of Epstein-Barr virus nuclear antigen 2 (EBNA 2), a transcriptional activator that is required for B-lymphocyte transformation. Other transcription factors that interac
• OMIM: 605689

Protein Summary

• Protein general information: Q7KZF4  
  • Name: Staphylococcal nuclease domain containing protein 1 (EC 3.1.31.1) (100 kDa coactivator) (EBNA2 coactivator p100) (Tudor domain containing protein 11) (p100 co activator)
  • Length: 910  
  • Mass: 101997
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MASSAQSGGSSGGPAVPTVQRGIIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLARRAAATQPDAKDTPD
  EPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNGENIAESLVAEGLATRREGMRANNPEQNRLS
  ECEEQAKAAKKGMWSEGNGSHTIRDLKYTIENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPDYYLVTVMLSG
  IKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWS
  IAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQVLNADAIVVKLNSGDYKTIHLSSIRP
  PRLEGENTQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVDYIRPASPATETVPAFSERTCATVTIGGINI
  AEALVSKGLATVIRYRQDDDQRSSHYDELLAAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAG
  RSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVES
  MDKAGNFIGWLHIDGANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAHYEEQPVEEVMPVLEE
  KERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVDGEWYRARV
  EKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQ
  CLLNVEHLSAGCPHVTLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRA
  DDADEFGYSR

• Structural information:
  • Protein Domains: (18..16-)
    (/note="TNase-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00272-)
    (193..32-)
    (/note="TNase-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00272-)
    (341..49-)
    (/note="TNase-like-3)
    (/evidence="ECO:0000255|PROSITE-Pr-)
  • Interpro: IPR016685  IPR035437  IPR016071  IPR002071  IPR002999  
  • Prosite: PS01284 PS50830 PS50304
  • PDB: 2E6N 2HQE 2HQX 2O4X 3BDL 3OMC 3OMG 4QMG 5M9O
  • PDBsum: 2E6N 2HQE 2HQX 2O4X 3BDL 3OMC 3OMG 4QMG 5M9O
  • DIP: 29613
  • STRING: ENSP00000346762
• Other Databases: GeneCards:  SND1  Malacards:  SND1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0004518	nuclease activity	IBA	molecular function
GO:0006401	RNA catabolic process	IBA	biological process
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0004518	nuclease activity	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0016442	RISC complex	IEA	cellular component
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0004518	nuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0003712	transcription coregulator activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097433	dense body	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045296	cadherin binding	HDA	molecular function
GO:0042470	melanosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1903506	regulation of nucleic acid-templated transcription	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0004521	endoribonuclease activity	IDA	molecular function
GO:1905172	RISC complex binding	IDA	molecular function
GO:0010587	miRNA catabolic process	IDA	biological process
GO:0003723	RNA binding	IDA	molecular function
GO:0004519	endonuclease activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0010564	regulation of cell cycle process	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0001649	osteoblast differentiation	HDA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05203	Viral carcinogenesis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray