• Gene id: 27040

Gene Summary

• Gene Symbol: LAT   Gene   UCSC   Ensembl
• Aliases: IMD52, LAT1, pp36
• Gene name: linker for activation of T cells
• Alternate names: linker for activation of T-cells family member 1, 36 kDa phospho-tyrosine adapter protein, 36 kDa phospho-tyrosine adaptor protein, linker for activation of T cells, transmembrane adaptor, p36-38,
• Gene location: 16p11.2 (28984802: 28990783)     Exons: 12     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is phosphorylated by ZAP-70/Syk protein tyrosine kinases following activation of the T-cell antigen receptor (TCR) signal transduction pathway. This transmembrane protein localizes to lipid rafts and acts as a docking site
• OMIM: 300059

Protein Summary

• Protein general information: O43561  
  • Name: Linker for activation of T cells family member 1 (36 kDa phospho tyrosine adapter protein) (pp36) (p36 38)
  • Length: 262  
  • Mass: 27930
  • Tissue specificity: Expressed in thymus, T-cells, NK cells, mast cells and, at lower levels, in spleen. Present in T-cells but not B-cells (at protein level). {ECO
• Sequence:

  MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQ
  PDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSLPPEPACEDAD
  EDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESAEASLDGSREYVNVSQ
  ELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN

• Structural information:
  • Interpro: IPR008359  
  • DIP: 29231
• Other Databases: GeneCards:  LAT  Malacards:  LAT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045121	membrane raft	TAS	cellular component
GO:0007229	integrin-mediated signaling pathway	IDA	biological process
GO:0006955	immune response	IDA	biological process
GO:0001772	immunological synapse	IDA	cellular component
GO:0007265	Ras protein signal transduction	IMP	biological process
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0030159	signaling receptor complex adaptor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045121	membrane raft	TAS	cellular component
GO:0050863	regulation of T cell activation	IMP	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0019722	calcium-mediated signaling	IMP	biological process
GO:0045860	positive regulation of protein kinase activity	IEP	biological process
GO:0006954	inflammatory response	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0045860	positive regulation of protein kinase activity	IBA	biological process
GO:0001772	immunological synapse	IBA	cellular component
GO:0050863	regulation of T cell activation	IBA	biological process
GO:0042110	T cell activation	TAS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0043303	mast cell degranulation	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000165	MAPK cascade	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0005911	cell-cell junction	IEA	cellular component
GO:0002260	lymphocyte homeostasis	IEA	biological process
GO:0001772	immunological synapse	IEA	cellular component
GO:0048872	homeostasis of number of cells	IEA	biological process
GO:0010467	gene expression	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0042629	mast cell granule	IEA	cellular component
GO:0008180	COP9 signalosome	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa05135	Yersinia infection
hsa04650	Natural killer cell mediated cytotoxicity
hsa04064	NF-kappa B signaling pathway
hsa04660	T cell receptor signaling pathway
hsa04666	Fc gamma R-mediated phagocytosis
hsa04659	Th17 cell differentiation
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa04658	Th1 and Th2 cell differentiation
hsa04664	Fc epsilon RI signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881