• Gene id: 27037

Gene Summary

• Gene Symbol: TRMT2A   Gene   UCSC   Ensembl
• Aliases: HTF9C
• Gene name: tRNA methyltransferase 2 homolog A
• Alternate names: tRNA (uracil-5-)-methyltransferase homolog A, TRM2 tRNA methyltransferase 2 homolog A, hpaII tiny fragments locus 9c protein,
• Gene location: 22q11.21 (112255041: 112211528)     Exons: 12     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is of unknown function. However, it is orthologous to the mouse Trmt2a gene and contains an RNA methyltransferase domain. Expression of this gene varies during the cell cycle, with aberrant expression being a possible biom
• OMIM: 611151

Protein Summary

• Protein general information: Q8IZ69  
  • Name: tRNA (uracil 5 ) methyltransferase homolog A (EC 2.1.1. ) (HpaII tiny fragments locus 9c protein)
  • Length: 625  
  • Mass: 68726
• Sequence:

  MSENLDNEGPKPMESCGQESSSALSCPTVSVPPAAPAALEEVEKEGAGAATGPGPQPGLYSYIRDDLFTSEIFKL
  ELQNVPRHASFSDVRRFLGRFGLQPHKTKLFGQPPCAFVTFRSAAERDKALRVLHGALWKGRPLSVRLARPKADP
  MARRRRQEGESEPPVTRVADVVTPLWTVPYAEQLERKQLECEQVLQKLAKEIGSTNRALLPWLLEQRHKHNKACC
  PLEGVRPSPQQTEYRNKCEFLVGVGVDGEDNTVGCRLGKYKGGTCAVAAPFDTVHIPEATKQVVKAFQEFIRSTP
  YSAYDPETYTGHWKQLTVRTSRRHQAMAIAYFHPQKLSPEELAELKTSLAQHFTAGPGRASGVTCLYFVEEGQRK
  TPSQEGLPLEHVAGDRCIHEDLLGLTFRISPHAFFQVNTPAAEVLYTVIQDWAQLDAGSMVLDVCCGTGTIGLAL
  ARKVKRVIGVELCPEAVEDARVNAQDNELSNVEFHCGRAEDLVPTLVSRLASQHLVAILDPPRAGLHSKVILAIR
  RAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGP
  HSPPAQPTPGPPDNTLQETGTFPSS

• Structural information:
  • Protein Domains: (73..14-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR000504  IPR029063  IPR034262   IPR010280  
  • Prosite: PS50102 PS51687
  • CDD: cd12439
  • STRING: ENSP00000252136
• Other Databases: GeneCards:  TRMT2A  Malacards:  TRMT2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006396	RNA processing	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0008173	RNA methyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001510	RNA methylation	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881