• Gene id: 27035

Gene Summary

• Gene Symbol: NOX1   Gene   UCSC   Ensembl
• Aliases: GP91-2, MOX1, NOH-1, NOH1
• Gene name: NADPH oxidase 1
• Alternate names: NADPH oxidase 1, NADH/NADPH mitogenic oxidase subunit P65-MOX, NADPH oxidase homolog-1, mitogenic oxidase (pyridine nucleotide-dependent superoxide-generating), mitogenic oxidase 1,
• Gene location: Xq22.1 (100874358: 100843323)     Exons: 14     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the NADPH oxidase family of enzymes responsible for the catalytic one-electron transfer of oxygen to generate superoxide or hydrogen peroxide. Alternatively spliced transcript variants encoding multiple isoforms have been obs
• OMIM: 300225

Protein Summary

• Protein general information: Q9Y5S8  
  • Name: NADPH oxidase 1 (NOX 1) (EC 1. . . ) (Mitogenic oxidase 1) (MOX 1) (NADH/NADPH mitogenic oxidase subunit P65 MOX) (NOH 1)
  • Length: 564  
  • Mass: 64871
  • Tissue specificity: NOH-1L is detected in colon, uterus, prostate, and colon carcinoma, but not in peripheral blood leukocytes. NOH-1S is detected only in colon and colon carcinoma cells.
• Sequence:

  MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNL
  LSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKK
  GGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGG
  IVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKV
  VMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSP
  IPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNN
  LLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSV
  VGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF

• Structural information:
  • Protein Domains: (54..28-)
    (/note="Ferric-oxidoreductase)
    (284..39-)
    (/note="FAD-binding-FR-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00716"-)
  • Interpro: IPR000778  IPR013112  IPR017927  IPR013130  IPR013121   IPR039261  IPR029650  IPR017938  
  • Prosite: PS51384
  • DIP: 60457
  • STRING: ENSP00000362057
• Other Databases: GeneCards:  NOX1  Malacards:  NOX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006952	defense response	IBA	biological process
GO:0042554	superoxide anion generation	IBA	biological process
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0016175	superoxide-generating NADPH oxidase activity	IBA	molecular function
GO:0043020	NADPH oxidase complex	IBA	cellular component
GO:0042554	superoxide anion generation	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016175	superoxide-generating NADPH oxidase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005244	voltage-gated ion channel activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0034765	regulation of ion transmembrane transport	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1902177	positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IEA	biological process
GO:0072592	oxygen metabolic process	IEA	biological process
GO:0042554	superoxide anion generation	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0071455	cellular response to hyperoxia	IEA	biological process
GO:0046330	positive regulation of JNK cascade	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0016175	superoxide-generating NADPH oxidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003081	regulation of systemic arterial blood pressure by renin-angiotensin	IEA	biological process
GO:0016175	superoxide-generating NADPH oxidase activity	IMP	molecular function
GO:0050661	NADP binding	IC	molecular function
GO:0016175	superoxide-generating NADPH oxidase activity	IC	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016175	superoxide-generating NADPH oxidase activity	TAS	molecular function
GO:0048365	Rac GTPase binding	IPI	molecular function
GO:0006739	NADP metabolic process	IC	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0042554	superoxide anion generation	IDA	biological process
GO:0042743	hydrogen peroxide metabolic process	IDA	biological process
GO:0051454	intracellular pH elevation	IDA	biological process
GO:0055114	oxidation-reduction process	IDA	biological process
GO:1990451	cellular stress response to acidic pH	IDA	biological process
GO:0001525	angiogenesis	IMP	biological process
GO:0042554	superoxide anion generation	IMP	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0008217	regulation of blood pressure	TAS	biological process
GO:0016477	cell migration	IMP	biological process
GO:0045730	respiratory burst	TAS	biological process
GO:0005769	early endosome	IDA	cellular component
GO:0043020	NADPH oxidase complex	IDA	cellular component
GO:0006954	inflammatory response	TAS	biological process
GO:0010575	positive regulation of vascular endothelial growth factor production	IEP	biological process
GO:0045726	positive regulation of integrin biosynthetic process	IMP	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	ISS	biological process
GO:0071438	invadopodium membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0071438	invadopodium membrane	IDA	cellular component
GO:0016175	superoxide-generating NADPH oxidase activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa04380	Osteoclast differentiation
hsa05418	Fluid shear stress and atherosclerosis
hsa04933	AGE-RAGE signaling pathway in diabetic complications

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881