• Gene id: 27023

Gene Summary

• Gene Symbol: FOXB1   Gene   UCSC   Ensembl
• Aliases: FKH5, HFKH-5
• Gene name: forkhead box B1
• Alternate names: forkhead box protein B1, transcription factor FKH-5,
• Gene location: 15q22.2 (60004310: 60007443)     Exons: 2     NC_000015.10
• OMIM: 300334

Protein Summary

• Protein general information: Q99853  
  • Name: Forkhead box protein B1 (Transcription factor FKH 5)
  • Length: 325  
  • Mass: 34978
• Sequence:

  MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIP
  RRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSDHLAPSKPADAAQYLQQQAKLRLSALAASGTHLPQM
  PAAAYNLGGVAQPSGFKHPFAIENIIAREYKMPGGLAFSAMQPVPAAYPLPNQLTTMGSSLGTGWPHVYGSAGMI
  DSATPISMASGDYSAYGVPLKPLCHAAGQTLPAIPVPIKPTPAAVPALPALPAPIPTLLSNSPPSLSPTSSQTAT
  SQSSPATPSETLTSPASALHSVAVH

• Structural information:
  • Interpro: IPR001766  IPR018122  IPR030456  IPR036388  IPR036390  
  • Prosite: PS00657 PS00658 PS50039
  • CDD: cd00059
  • STRING: ENSP00000379369
• Other Databases: GeneCards:  FOXB1  Malacards:  FOXB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0030154	cell differentiation	IBA	biological process
GO:0009653	anatomical structure morphogenesis	IBA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001655	urogenital system development	IEA	biological process
GO:0007595	lactation	IEA	biological process
GO:0021510	spinal cord development	IEA	biological process
GO:0021767	mammillary body development	IEA	biological process
GO:0021794	thalamus development	IEA	biological process
GO:0021855	hypothalamus cell migration	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0061030	epithelial cell differentiation involved in mammary gland alveolus development	IEA	biological process
GO:0061381	cell migration in diencephalon	IEA	biological process
GO:0001756	somitogenesis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0007412	axon target recognition	IEA	biological process
GO:0008542	visual learning	IEA	biological process
GO:0022029	telencephalon cell migration	IEA	biological process
GO:0030901	midbrain development	IEA	biological process
GO:0033504	floor plate development	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0061374	mammillothalamic axonal tract development	IEA	biological process
GO:0061377	mammary gland lobule development	IEA	biological process
GO:0061379	inferior colliculus development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0061374	mammillothalamic axonal tract development	ISS	biological process
GO:0043524	negative regulation of neuron apoptotic process	ISS	biological process
GO:0030901	midbrain development	ISS	biological process
GO:0007412	axon target recognition	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0001756	somitogenesis	ISS	biological process
GO:0061030	epithelial cell differentiation involved in mammary gland alveolus development	ISS	biological process
GO:0043565	sequence-specific DNA binding	ISS	molecular function
GO:0021855	hypothalamus cell migration	ISS	biological process
GO:0007595	lactation	ISS	biological process
GO:0061379	inferior colliculus development	ISS	biological process
GO:0061377	mammary gland lobule development	ISS	biological process
GO:0033504	floor plate development	ISS	biological process
GO:0022029	telencephalon cell migration	ISS	biological process
GO:0008542	visual learning	ISS	biological process
GO:0061381	cell migration in diencephalon	ISS	biological process
GO:0021767	mammillary body development	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray