• Gene id: 27018

Gene Summary

• Gene Symbol: BEX3   Gene   UCSC   Ensembl
• Aliases: Bex, DXS6984E, HGR74, NADE, NGFRAP1
• Gene name: brain expressed X-linked 3
• Alternate names: protein BEX3, brain-expressed X-linked protein 3, nerve growth factor receptor (TNFRSF16) associated protein 1, ovarian granulosa cell 13.0 kDa protein HGR74, p75NTR-associated cell death executor,
• Gene location: Xq22.2 (103376322: 103378163)     Exons: 3     NC_000023.11
• OMIM: 300361

Protein Summary

• Protein general information: Q00994  
  • Name: Protein BEX3 (Brain expressed X linked protein 3) (Nerve growth factor receptor associated protein 1) (Ovarian granulosa cell 13.0 kDa protein HGR74) (p75NTR associated cell death executor)
  • Length: 111  
  • Mass: 12959
  • Tissue specificity: Found in ovarian granulosa cells, testis, prostate and seminal vesicle tissue. High levels also detected in liver. {ECO
• Sequence:

  MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMR
  EIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

• Structural information:
  • Interpro: IPR007623  IPR021156  
  • PDB: 1SA6
  • PDBsum: 1SA6
  • STRING: ENSP00000361728
• Other Databases: GeneCards:  BEX3  Malacards:  BEX3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0007165	signal transduction	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0007275	multicellular organism development	TAS	biological process
GO:0008656	cysteine-type endopeptidase activator activity involved in apoptotic process	TAS	molecular function
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005163	nerve growth factor receptor binding	IEA	molecular function
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005123	death receptor binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04722	Neurotrophin signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray