• Gene id: 27005

Gene Summary

• Gene Symbol: USP21   Gene   UCSC   Ensembl
• Aliases: USP16, USP23
• Gene name: ubiquitin specific peptidase 21
• Alternate names: ubiquitin carboxyl-terminal hydrolase 21, NEDD8-specific protease, deubiquitinating enzyme 21, ubiquitin specific protease 21, ubiquitin thioesterase 21, ubiquitin thiolesterase 21, ubiquitin-specific processing protease 21, ubiquitin-specific protease 16,
• Gene location: 1q23.3 (161159486: 161165751)     Exons: 13     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the C19 peptidase family, also known as family 2 of ubiquitin carboxy-terminal hydrolases. The encoded protein cleaves ubiquitin from ubiquitinated proteins for recycling in intracellular protein degradation. The encoded prot
• OMIM: 602181

Protein Summary

• Protein general information: Q9UK80  
  • Name: Ubiquitin carboxyl terminal hydrolase 21 (EC 3.4.19.12) (Deubiquitinating enzyme 21) (Ubiquitin thioesterase 21) (Ubiquitin specific processing protease 21)
  • Length: 565  
  • Mass: 62656
  • Tissue specificity: Highly expressed in heart, pancreas and skeletal muscle. Also expressed in brain, placenta, liver and kidney, and at very low level in lung. {ECO
• Sequence:

  MPQASEHRLGRTREPPVNIQPRVGSKLPFAPRARSKERRNPASGPNPMLRPLPPRPGLPDERLKKLELGRGRTSG
  PRPRGPLRADHGVPLPGSPPPTVALPLPSRTNLARSKSVSSGDLRPMGIALGGHRGTGELGAALSRLALRPEPPT
  LRRSTSLRRLGGFPGPPTLFSIRTEPPASHGSFHMISARSSEPFYSDDKMAHHTLLLGSGHVGLRNLGNTCFLNA
  VLQCLSSTRPLRDFCLRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNPTRFRAVFQKYVPSFSGYSQQ
  DAQEFLKLLMERLHLEINRRGRRAPPILANGPVPSPPRRGGALLEEPELSDDDRANLMWKRYLEREDSKIVDLFV
  GQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCFNLFTKEEELESENAPVCDRCRQKTRSTKKL
  TVQRFPRILVLHLNRFSASRGSIKKSSVGVDFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRC
  QTGWHVYNDSRVSPVSENQVASSEGYVLFYQLMQEPPRCL

• Structural information:
  • Protein Domains: (212..55-)
    (/note="USP"-)
  • Interpro: IPR038765  IPR001394  IPR018200  IPR028889  
  • Prosite: PS00972 PS00973 PS50235
  • PDB: 2Y5B 3I3T 3MTN
  • PDBsum: 2Y5B 3I3T 3MTN
  • DIP: 31255
  • STRING: ENSP00000356981
• Other Databases: GeneCards:  USP21  Malacards:  USP21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0016578	histone deubiquitination	ISS	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IMP	molecular function
GO:0008234	cysteine-type peptidase activity	ISS	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	ISS	molecular function
GO:0003713	transcription coactivator activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0016579	protein deubiquitination	IEA	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0016579	protein deubiquitination	TAS	biological process
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031175	neuron projection development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0019784	NEDD8-specific protease activity	IDA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IDA	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	TAS	molecular function
GO:0008234	cysteine-type peptidase activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04217	Necroptosis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R