• Gene id: 26998

Gene Summary

• Gene Symbol: FETUB   Gene   UCSC   Ensembl
• Aliases: 16G2, Gugu, IRL685
• Gene name: fetuin B
• Alternate names: fetuin-B, fetuin-like protein IRL685,
• Gene location: 3q27.3 (186635968: 186653140)     Exons: 8     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the fetuin family, part of the cystatin superfamily of cysteine protease inhibitors. Fetuins have been implicated in several diverse functions, including osteogenesis and bone resorption, regulation of the i

Protein Summary

• Protein general information: Q9UGM5  
  • Name: Fetuin B (16G2) (Fetuin like protein IRL685) (Gugu)
  • Length: 382  
  • Mass: 42055
  • Tissue specificity: Liver and testis.
• Sequence:

  MGLLLPLALCILVLCCGAMSPPQLALNPSALLSRGCNDSDVLAVAGFALRDINKDRKDGYVLRLNRVNDAQEYRR
  GGLGSLFYLTLDVLETDCHVLRKKAWQDCGMRIFFESVYGQCKAIFYMNNPSRVLYLAAYNCTLRPVSKKKIYMT
  CPDCPSSIPTDSSNHQVLEAATESLAKYNNENTSKQYSLFKVTRASSQWVVGPSYFVEYLIKESPCTKSQASSCS
  LQSSDSVPVGLCKGSLTRTHWEKFVSVTCDFFESQAPATGSENSAVNQKPTNLPKVEESQQKNTPPTDSPSKAGP
  RGSVQYLPDLDDKNSQEKGPQEAFPVHLDLTTNPQGETLDISFLFLEPMEEKLVVLPFPKEKARTAECPGPAQNA
  SPLVLPP

• Structural information:
  • Protein Domains: (25..13-)
    1 (/note="Cystatin-fetuin-B-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00862-)
    (149..25-)
    2 (/note="Cystatin-fetuin-B-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00862"-)
  • Interpro: IPR000010  IPR025764  IPR001363  
  • Prosite: PS51530 PS01254 PS01255
  • CDD: cd00042
  • PDB: 6SAZ
  • PDBsum: 6SAZ
  • STRING: ENSP00000265029
• Other Databases: GeneCards:  FETUB  Malacards:  FETUB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0004869	cysteine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IBA	cellular component
GO:0004866	endopeptidase inhibitor activity	IBA	molecular function
GO:0010951	negative regulation of endopeptidase activity	IBA	biological process
GO:0008191	metalloendopeptidase inhibitor activity	IBA	molecular function
GO:0007339	binding of sperm to zona pellucida	IBA	biological process
GO:0004857	enzyme inhibitor activity	IEA	molecular function
GO:0007338	single fertilization	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0008191	metalloendopeptidase inhibitor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007338	single fertilization	IEA	biological process
GO:0007339	binding of sperm to zona pellucida	IEA	biological process
GO:0008191	metalloendopeptidase inhibitor activity	IEA	molecular function
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007338	single fertilization	ISS	biological process
GO:0010951	negative regulation of endopeptidase activity	ISS	biological process
GO:0008191	metalloendopeptidase inhibitor activity	ISS	molecular function
GO:0007339	binding of sperm to zona pellucida	ISS	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R