• Gene id: 26996

Gene Summary

• Gene Symbol: GPR160   Gene   UCSC   Ensembl
• Aliases: GPCR1, GPCR150
• Gene name: G protein-coupled receptor 160
• Alternate names: probable G-protein coupled receptor 160, G-protein coupled receptor GPCR1, hGPCR1, putative G protein-coupled receptor,
• Gene location: 3q26.2 (170037994: 170085416)     Exons: 7     NC_000003.12

Protein Summary

• Protein general information: Q9UJ42  
  • Name: Probable G protein coupled receptor 160 (G protein coupled receptor GPCR1) (hGPCR1)
  • Length: 338  
  • Mass: 39787
• Sequence:

  MTALSSENCSFQYQLRQTNQPLDVNYLLFLIILGKILLNILTLGMRRKNTCQNFMEYFCISLAFVDLLLLVNISI
  ILYFRDFVLLSIRFTKYHICLFTQIISFTYGFLHYPVFLTACIDYCLNFSKTTKLSFKCQKLFYFFTVILIWISV
  LAYVLGDPAIYQSLKAQNAYSRHCPFYVSIQSYWLSFFMVMILFVAFITCWEEVTTLVQAIRITSYMNETILYFP
  FSSHSSYTVRSKKIFLSKLIVCFLSTWLPFVLLQVIIVLLKVQIPAYIEMNIPWLYFVNSFLIATVYWFNCHKLN
  LKDIGLPLDPFVNWKCCFIPLTIPNLEQIEKPISIMIC

• Structural information:
  • Interpro: IPR017452  IPR042353  
  • Prosite: PS50262
  • STRING: ENSP00000348161
• Other Databases: GeneCards:  GPR160  Malacards:  GPR160

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043235	receptor complex	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray