About Us

Search Result


Gene id 26993
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol AKAP8L   Gene   UCSC   Ensembl
Aliases HA95, HAP95, NAKAP, NAKAP95
Gene name A-kinase anchoring protein 8 like
Alternate names A-kinase anchor protein 8-like, A kinase (PRKA) anchor protein 8-like, AKAP8-like protein, helicase A-binding protein 95 kDa, homologous to AKAP95 protein, neighbor of A-kinase anchoring protein 95, neighbor of AKAP95, testis tissue sperm-binding protein Li 90mP,
Gene location 19p13.12 (15418987: 15380049)     Exons: 16     NC_000019.10
OMIM 604729

Protein Summary

Protein general information Q9ULX6  

Name: A kinase anchor protein 8 like (AKAP8 like protein) (Helicase A binding protein 95) (HAP95) (Homologous to AKAP95 protein) (HA95) (Neighbor of A kinase anchoring protein 95) (Neighbor of AKAP95)

Length: 646  Mass: 71640

Tissue specificity: Ubiquitously expressed. Expressed in the brain cortex (at protein level). {ECO

Sequence MSYTGFVQGSETTLQSTYSDTSAQPTCDYGYGTWNSGTNRGYEGYGYGYGYGQDNTTNYGYGMATSHSWEMPSSD
TNANTSASGSASADSVLSRINQRLDMVPHLETDMMQGGVYGSGGERYDSYESCDSRAVLSERDLYRSGYDYSELD
PEMEMAYEGQYDAYRDQFRMRGNDTFGPRAQGWARDARSGRPMASGYGRMWEDPMGARGQCMSGASRLPSLFSQN
IIPEYGMFQGMRGGGAFPGGSRFGFGFGNGMKQMRRTWKTWTTADFRTKKKKRKQGGSPDEPDSKATRTDCSDNS
DSDNDEGTEGEATEGLEGTEAVEKGSRVDGEDEEGKEDGREEGKEDPEKGALTTQDENGQTKRKLQAGKKSQDKQ
KKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYVGTKLPKQTADFLQEYVTNKTKKTEELRKTV
EDLDGLIQQIYRDQDLTQEIAMEHFVKKVEAAHCAACDLFIPMQFGIIQKHLKTMDHNRNRRLMMEQSKKSSLMV
ARSILNNKLISKKLERYLKGENPFTDSPEEEKEQEEAEGGALDEGAQGEAAGISEGAEGVPAQPPVPPEPAPGAV
SPPPPPPPEEEEEGAVPLLGGALQRQIRGIPGLDVEDDEEGGGGAP
Structural information
Interpro:  IPR007071  IPR034736  
Prosite:   PS51799

DIP:  

27541

MINT:  
STRING:   ENSP00000380557
Other Databases GeneCards:  AKAP8L  Malacards:  AKAP8L

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0034237 protein kinase A regulato
ry subunit binding
IBA molecular function
GO:0016363 nuclear matrix
IBA cellular component
GO:0016363 nuclear matrix
IDA cellular component
GO:0010793 regulation of mRNA export
from nucleus
IDA biological process
GO:0016363 nuclear matrix
IDA cellular component
GO:0005521 lamin binding
IDA molecular function
GO:1990904 ribonucleoprotein complex
IDA cellular component
GO:0042826 histone deacetylase bindi
ng
IDA molecular function
GO:0045944 positive regulation of tr
anscription by RNA polyme
rase II
IDA biological process
GO:0006397 mRNA processing
IDA biological process
GO:0016607 nuclear speck
IDA cellular component
GO:0000785 chromatin
IDA cellular component
GO:0005737 cytoplasm
IDA cellular component
GO:0005634 nucleus
IDA cellular component
GO:0044839 cell cycle G2/M phase tra
nsition
IMP biological process
GO:0051081 nuclear envelope disassem
bly
IMP biological process
GO:0007076 mitotic chromosome conden
sation
IMP biological process
GO:0031065 positive regulation of hi
stone deacetylation
IMP biological process
GO:0033127 regulation of histone pho
sphorylation
IMP biological process
GO:0005515 protein binding
IPI molecular function
GO:0003677 DNA binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0046872 metal ion binding
IEA molecular function
GO:0005634 nucleus
IEA cellular component
GO:0006397 mRNA processing
IEA biological process
GO:0008380 RNA splicing
IEA biological process
GO:0005737 cytoplasm
IEA cellular component
GO:0016032 viral process
IEA biological process
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0016363 nuclear matrix
IEA cellular component
GO:0005737 cytoplasm
IEA cellular component
GO:0016605 PML body
IEA cellular component
GO:0016607 nuclear speck
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0016607 nuclear speck
IDA cellular component
GO:0017151 DEAD/H-box RNA helicase b
inding
TAS molecular function
GO:0003723 RNA binding
HDA molecular function
GO:0003723 RNA binding
HDA molecular function
GO:0005634 nucleus
TAS cellular component
Associated diseases References
Cryptorchidism MIK: 28606200
Spermatogenic defects MIK: 31037746

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28606200 Cryptorchi
dism

Monozgotic twin
s (1 control, I
cwith cryptorc
hidism)
Male infertility MeDIP-Seq
Show abstract
31037746 Spermatoge
nic defect
s

16 (1 control,
15 cases)
Male infertility GSE6023 analyzed using GEO2R
Show abstract