• Gene id: 26986

Gene Summary

• Gene Symbol: PABPC1   Gene   UCSC   Ensembl
• Aliases: PAB1, PABP, PABP1, PABPC2, PABPL1
• Gene name: poly(A) binding protein cytoplasmic 1
• Alternate names: polyadenylate-binding protein 1, poly(A) binding protein, cytoplasmic 2,
• Gene location: 8q22.3 (100722086: 100702915)     Exons: 15     NC_000008.11
• Gene summary(Entrez): This gene encodes a poly(A) binding protein. The protein shuttles between the nucleus and cytoplasm and binds to the 3' poly(A) tail of eukaryotic messenger RNAs via RNA-recognition motifs. The binding of this protein to poly(A) promotes ribosome recruitm
• OMIM: 604679

Protein Summary

• Protein general information: P11940  
  • Name: Polyadenylate binding protein 1 (PABP 1) (Poly(A) binding protein 1)
  • Length: 636  
  • Mass: 70,671
• Sequence:

  MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFD
  VIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSCKVVCDENGSKGYGFVHFETQEA
  AERAIEKMNGMLLNDRKVFVGRFKSRKEREAELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTD
  ESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN
  LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVATKPLYVALAQRKEERQ
  AHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRAAYYPPSQIAQLRPSPRWTAQGARPHPFQNM
  PGAIRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLN
  AQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESP
  ESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV

• Structural information:
  • Protein Domains: RRM (11-89)
    RRM (99-175)
    RRM (191-268)
    RRM (294-370)
    (-)
  • Interpro: IPR012677  IPR036053  IPR006515  IPR002004  IPR035979   IPR000504  IPR003954  
  • Prosite: PS51309 PS50102
  • PDB: 1CVJ 1G9L 1JGN 1JH4 2K8G 2RQG 2RQH 2X04 3KTP 3KTR 3KUI 3KUJ 3KUR 3KUS 3KUT 3PKN 3PTH 4F02 4F25 4F26 5DX1 5DX8 5DXA 5LGP 5LGQ 5LGR 5LGS
  • PDBsum: 1CVJ 1G9L 1JGN 1JH4 2K8G 2RQG 2RQH 2X04 3KTP 3KTR 3KUI 3KUJ 3KUR 3KUS 3KUT 3PKN 3PTH 4F02 4F25 4F26 5DX1 5DX8 5DXA 5LGP 5LGQ 5LGR 5LGS
  • DIP: 31613
  • STRING: ENSP00000313007
• Other Databases: GeneCards:  PABPC1  Malacards:  PABPC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS	biological process
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006378	mRNA polyadenylation	TAS	biological process
GO:0006413	translational initiation	TAS	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0008143	poly(A) binding	IDA	molecular function
GO:0008143	poly(A) binding	IDA	molecular function
GO:0008143	poly(A) binding	TAS	molecular function
GO:0008266	poly(U) RNA binding	IDA	molecular function
GO:0008494	translation activator activity	TAS	molecular function
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0030529	intracellular ribonucleoprotein complex	IDA	cellular component
GO:0031047	gene silencing by RNA	ISS	biological process
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045070	positive regulation of viral genome replication	IMP	biological process
GO:0045727	positive regulation of translation	IEA	biological process
GO:0048255	mRNA stabilization	TAS	biological process
GO:0060213	positive regulation of nuclear-transcribed mRNA poly(A) tail shortening	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	ISS	biological process
GO:2000623	negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IDA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IEA	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS	biological process
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006378	mRNA polyadenylation	TAS	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0006413	translational initiation	TAS	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0008143	poly(A) binding	IDA	molecular function
GO:0008143	poly(A) binding	IDA	molecular function
GO:0008143	poly(A) binding	TAS	molecular function
GO:0008266	poly(U) RNA binding	IDA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0008494	translation activator activity	TAS	molecular function
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0030529	intracellular ribonucleoprotein complex	IDA	cellular component
GO:0031047	gene silencing by RNA	ISS	biological process
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045070	positive regulation of viral genome replication	IMP	biological process
GO:0045727	positive regulation of translation	IEA	biological process
GO:0048255	mRNA stabilization	TAS	biological process
GO:0060213	positive regulation of nuclear-transcribed mRNA poly(A) tail shortening	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	ISS	biological process
GO:2000623	negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IDA	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS	biological process
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0006378	mRNA polyadenylation	TAS	biological process
GO:0006413	translational initiation	TAS	biological process
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0008143	poly(A) binding	IDA	molecular function
GO:0008143	poly(A) binding	IDA	molecular function
GO:0008143	poly(A) binding	TAS	molecular function
GO:0008266	poly(U) RNA binding	IDA	molecular function
GO:0008494	translation activator activity	TAS	molecular function
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0010494	cytoplasmic stress granule	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0030529	intracellular ribonucleoprotein complex	IDA	cellular component
GO:0031047	gene silencing by RNA	ISS	biological process
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0044822	poly(A) RNA binding	IDA	molecular function
GO:0045070	positive regulation of viral genome replication	IMP	biological process
GO:0048255	mRNA stabilization	TAS	biological process
GO:0060213	positive regulation of nuclear-transcribed mRNA poly(A) tail shortening	ISS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	ISS	biological process
GO:2000623	negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IDA	biological process

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 26843391
Male factor infertility	MIK: 26843391
Male infertility	MIK: 26843391
Non-obstructive azoospermia	MIK: 26843391
Hypospermatogenesis	MIK: 26843391
RS arrest	MIK: 26843391
SC arrest	MIK: 26843391
Sertoli cell-only syndrome (SCOS)	MIK: 26843391
Male infertility	MIK: 26843391
Role in spermiogenesis	MIK: 26971890
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26971890	Role in spermiogenesis, Male infertility				Male infertility
26843391	NOA including hypospermatogenesis (hyposperm), RS arrest, SC arrest, and Sertoli cell-only syndrome (SCO), Male infertility				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)