• Gene id: 26973

Gene Summary

• Gene Symbol: CHORDC1   Gene   UCSC   Ensembl
• Aliases: CHP1
• Gene name: cysteine and histidine rich domain containing 1
• Alternate names: cysteine and histidine-rich domain-containing protein 1, CHORD-containing protein 1, CHP-1, chord domain-containing protein 1, cysteine and histidine-rich domain (CHORD) containing 1, cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein ,
• Gene location: 11q14.3 (90223363: 90200428)     Exons: 14     NC_000011.10
• OMIM: 604353

Protein Summary

• Protein general information: Q9UHD1  
  • Name: Cysteine and histidine rich domain containing protein 1 (CHORD domain containing protein 1) (CHORD containing protein 1) (CHP 1) (Protein morgana)
  • Length: 332  
  • Mass: 37490
  • Tissue specificity: Underexpressed in many breast and lung cancers. {ECO
• Sequence:

  MALLCYNRGCGQRFDPETNSDDACTYHPGVPVFHDALKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKP
  EVKTTEKKELCELKPKFQEHIIQAPKPVEAIKRPSPDEPMTNLELKISASLKQALDKLKLSSGNEENKKEEDNDE
  IKIGTSCKNGGCSKTYQGLESLEEVCVYHSGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGK
  KVVPCRHDWHQTGGEVTISVYAKNSLPELSRVEANSTLLNVHIVFEGEKEFDQNVKLWGVIDVKRSYVTMTATKI
  EITMRKAEPMQWASLELPAAKKQEKQKDATTD

• Structural information:
  • Protein Domains: (5..6-)
    (/note="CHORD-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00734-)
    (157..21-)
    (/note="CHORD-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00734-)
    (227..31-)
    (/note="CS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00547"-)
  • Interpro: IPR007051  IPR039790  IPR007052  IPR008978  
  • Prosite: PS51401 PS51203
  • PDB: 2YRT
  • PDBsum: 2YRT
  • STRING: ENSP00000319255
• Other Databases: GeneCards:  CHORDC1  Malacards:  CHORDC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IBA	molecular function
GO:0051298	centrosome duplication	IBA	biological process
GO:0061077	chaperone-mediated protein folding	ISS	biological process
GO:0051879	Hsp90 protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000299	negative regulation of Rho-dependent protein serine/threonine kinase activity	IEA	biological process
GO:1900034	regulation of cellular response to heat	IEA	biological process
GO:0061077	chaperone-mediated protein folding	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0043531	ADP binding	IEA	molecular function
GO:0010824	regulation of centrosome duplication	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005575	cellular_component	ND	cellular component
GO:1900034	regulation of cellular response to heat	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881