• Gene id: 2696

Gene Summary

• Gene Symbol: GIPR   Gene   UCSC   Ensembl
• Aliases: PGQTL2
• Gene name: gastric inhibitory polypeptide receptor
• Alternate names: gastric inhibitory polypeptide receptor, GIP-R, glucose-dependent insulinotropic polypeptide receptor,
• Gene location: 19q13.32 (45668186: 45683721)     Exons: 16     NC_000019.10
• Gene summary(Entrez): This gene encodes a G-protein coupled receptor for gastric inhibitory polypeptide (GIP), which was originally identified as an activity in gut extracts that inhibited gastric acid secretion and gastrin release, but subsequently was demonstrated to stimula
• OMIM: 137241

Protein Summary

• Protein general information: P48546  
  • Name: Gastric inhibitory polypeptide receptor (GIP R) (Glucose dependent insulinotropic polypeptide receptor)
  • Length: 466  
  • Mass: 53157
• Sequence:

  MTTSPILQLLLRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSGLACNGSFDMYVCWDYAA
  PNATARASCPWYLPWHHHVAAGFVLRQCGSDGQWGLWRDHTQCENPEKNEAFLDQRLILERLQVMYTVGYSLSLA
  TLLLALLILSLFRRLHCTRNYIHINLFTSFMLRAAAILSRDRLLPRPGPYLGDQALALWNQALAACRTAQIVTQY
  CVGANYTWLLVEGVYLHSLLVLVGGSEEGHFRYYLLLGWGAPALFVIPWVIVRYLYENTQCWERNEVKAIWWIIR
  TPILMTILINFLIFIRILGILLSKLRTRQMRCRDYRLRLARSTLTLVPLLGVHEVVFAPVTEEQARGALRFAKLG
  FEIFLSSFQGFLVSVLYCFINKEVQSEIRRGWHHCRLRRSLGEEQRQLPERAFRALPSGSGPGEVPTSRGLSSGT
  LPGPGNEASRELESYC

• Structural information:
  • Interpro: IPR017981  IPR036445  IPR001879  IPR001749  IPR000832   IPR017983  
  • Prosite: PS00649 PS00650 PS50227 PS50261
  • PDB: 2QKH 4HJ0 6DKJ
  • PDBsum: 2QKH 4HJ0 6DKJ
  • DIP: 46468
  • STRING: ENSP00000467494
• Other Databases: GeneCards:  GIPR  Malacards:  GIPR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050796	regulation of insulin secretion	TAS	biological process
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA	biological process
GO:0016519	gastric inhibitory peptide receptor activity	IBA	molecular function
GO:0017046	peptide hormone binding	IBA	molecular function
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0016519	gastric inhibitory peptide receptor activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0007190	activation of adenylate cyclase activity	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0006091	generation of precursor metabolites and energy	TAS	biological process
GO:0007584	response to nutrient	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051592	response to calcium ion	IEA	biological process
GO:0048678	response to axon injury	IEA	biological process
GO:0043950	positive regulation of cAMP-mediated signaling	IEA	biological process
GO:0017046	peptide hormone binding	IEA	molecular function
GO:0016519	gastric inhibitory peptide receptor activity	IEA	molecular function
GO:0009749	response to glucose	IEA	biological process
GO:0002029	desensitization of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0070542	response to fatty acid	IEA	biological process
GO:0032024	positive regulation of insulin secretion	IEA	biological process
GO:0007204	positive regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0031018	endocrine pancreas development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0038192	gastric inhibitory peptide signaling pathway	IEA	biological process
GO:0038192	gastric inhibitory peptide signaling pathway	IEA	biological process
GO:0038192	gastric inhibitory peptide signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway

Diseases

Associated diseases	References
cardiovascular system disease	PMID:17624916
diabetes mellitus	PMID:15582721
type 2 diabetes mellitus	PMID:19386626
obesity	PMID:17395281
obesity	PMID:19254363
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881