• Gene id: 26958

Gene Summary

• Gene Symbol: COPG2   Gene   UCSC   Ensembl
• Aliases: 2-COP, gamma-2-COP
• Gene name: COPI coat complex subunit gamma 2
• Alternate names: coatomer subunit gamma-2, coat protein, nonclathrin, gamma-2-cop, coatomer protein complex subunit gamma 2, gamma-2-coat protein, testicular secretory protein Li 12,
• Gene location: 7q32.2 (130668757: 130506237)     Exons: 24     NC_000007.14
• OMIM: 613598

Protein Summary

• Protein general information: Q9UBF2  
  • Name: Coatomer subunit gamma 2 (Gamma 2 coat protein) (Gamma 2 COP)
  • Length: 871  
  • Mass: 97622
• Sequence:

  MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTKILYLLNQGEHFGTTEATEAFFAMTR
  LFQSNDQTLRRMCYLTIKEMATISEDVIIVTSSLTKDMTGKEDVYRGPAIRALCRITDGTMLQAIERYMKQAIVD
  KVSSVSSSALVSSLHMMKISYDVVKRWINEAQEAASSDNIMVQYHALGVLYHLRKNDRLAVSKMLNKFTKSGLKS
  QFAYCMLIRIASRLLKETEDGHESPLFDFIESCLRNKHEMVIYEAASAIIHLPNCTARELAPAVSVLQLFCSSPK
  PALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGSESSVDRLMKQISSFVSEISDEF
  KVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEYKRAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTV
  LATKILHLLGKEGPRTPVPSKYIRFIFNRVVLENEAVRAAAVSALAKFGAQNESLLPSILVLLQRCMMDTDDEVR
  DRATFYLNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEPSEKPFDMKSIPLAMAPVFEQKAEITLVATKP
  EKLAPSRQDIFQEQLAAIPEFLNIGPLFKSSEPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVT
  VQMEPSDSYEVLSCIPAPSLPYNQPGICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNTGVPDEDGYDDEYVL
  EDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSL
  YLAGIFRGGYDLLVRSRLALADGVTMQVTVRSKERTPVDVILASVG

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR002553  IPR013041  IPR009028   IPR032154  IPR017106  IPR013040  IPR037067  IPR012295  
  • STRING: ENSP00000402346
• Other Databases: GeneCards:  COPG2  Malacards:  COPG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006891	intra-Golgi vesicle-mediated transport	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0000139	Golgi membrane	IBA	cellular component
GO:0072384	organelle transport along microtubule	IBA	biological process
GO:0030126	COPI vesicle coat	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0009306	protein secretion	IBA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0005198	structural molecule activity	IEA	molecular function
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0030117	membrane coat	IEA	cellular component
GO:0030126	COPI vesicle coat	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030126	COPI vesicle coat	IDA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030137	COPI-coated vesicle	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0030663	COPI-coated vesicle membrane	IEA	cellular component
GO:0006891	intra-Golgi vesicle-mediated transport	IDA	biological process
GO:0030126	COPI vesicle coat	IDA	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq