• Gene id: 2693

Gene Summary

• Gene Symbol: GHSR   Gene   UCSC   Ensembl
• Aliases: GHDP
• Gene name: growth hormone secretagogue receptor
• Alternate names: growth hormone secretagogue receptor type 1, GH-releasing peptide receptor, GHRP, GHS-R, ghrelin receptor,
• Gene location: 3q26.31 (172448455: 172443290)     Exons: 2     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the G-protein coupled receptor family. The encoded protein may play a role in energy homeostasis and regulation of body weight. Two identified transcript variants are expressed in several tissues and are evolutionary conserve
• OMIM: 601898

Protein Summary

• Protein general information: Q92847  
  • Name: Growth hormone secretagogue receptor type 1 (GHS R) (GH releasing peptide receptor) (GHRP) (Ghrelin receptor)
  • Length: 366  
  • Mass: 41329
  • Tissue specificity: Pituitary and hypothalamus.
• Sequence:

  MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELR
  TTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLR
  AKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPV
  FCLTVLYSLIGRKLWRRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
  SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWTESSINT

• Structural information:
  • Interpro: IPR039129  IPR003905  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000241256
• Other Databases: GeneCards:  GHSR  Malacards:  GHSR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009755	hormone-mediated signaling pathway	IDA	biological process
GO:0001616	growth hormone secretagogue receptor activity	IDA	molecular function
GO:0004930	G protein-coupled receptor activity	IDA	molecular function
GO:0016520	growth hormone-releasing hormone receptor activity	IDA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0008343	adult feeding behavior	ISS	biological process
GO:0032100	positive regulation of appetite	ISS	biological process
GO:0040018	positive regulation of multicellular organism growth	IMP	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0030252	growth hormone secretion	TAS	biological process
GO:0001616	growth hormone secretagogue receptor activity	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030252	growth hormone secretion	IEA	biological process
GO:0043568	positive regulation of insulin-like growth factor receptor signaling pathway	IEA	biological process
GO:0001616	growth hormone secretagogue receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0032354	response to follicle-stimulating hormone	IEA	biological process
GO:0042562	hormone binding	IEA	molecular function
GO:0045923	positive regulation of fatty acid metabolic process	IEA	biological process
GO:0045927	positive regulation of growth	IEA	biological process
GO:0051969	regulation of transmission of nerve impulse	IEA	biological process
GO:0060416	response to growth hormone	IEA	biological process
GO:0090327	negative regulation of locomotion involved in locomotory behavior	IEA	biological process
GO:0098696	regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IEA	biological process
GO:0099699	integral component of synaptic membrane	IEA	cellular component
GO:0120058	positive regulation of small intestinal transit	IEA	biological process
GO:1903672	positive regulation of sprouting angiogenesis	IEA	biological process
GO:1904468	negative regulation of tumor necrosis factor secretion	IEA	biological process
GO:1990314	cellular response to insulin-like growth factor stimulus	IEA	biological process
GO:2000110	negative regulation of macrophage apoptotic process	IEA	biological process
GO:0008343	adult feeding behavior	IEA	biological process
GO:0032094	response to food	IEA	biological process
GO:0032100	positive regulation of appetite	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0051963	regulation of synapse assembly	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0007611	learning or memory	IEA	biological process
GO:0010700	negative regulation of norepinephrine secretion	IEA	biological process
GO:0017046	peptide hormone binding	IEA	molecular function
GO:0032099	negative regulation of appetite	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0036321	ghrelin secretion	IEA	biological process
GO:0043134	regulation of hindgut contraction	IEA	biological process
GO:0046676	negative regulation of insulin secretion	IEA	biological process
GO:0060123	regulation of growth hormone secretion	IEA	biological process
GO:0060259	regulation of feeding behavior	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0071548	response to dexamethasone	IEA	biological process
GO:0097067	cellular response to thyroid hormone stimulus	IEA	biological process
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099170	postsynaptic modulation of chemical synaptic transmission	IEA	biological process
GO:0099175	regulation of postsynapse organization	IEA	biological process
GO:1904000	positive regulation of eating behavior	IEA	biological process
GO:1904008	response to monosodium glutamate	IEA	biological process
GO:1904349	positive regulation of small intestine smooth muscle contraction	IEA	biological process
GO:1905333	regulation of gastric motility	IEA	biological process
GO:1905564	positive regulation of vascular endothelial cell proliferation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0046697	decidualization	IDA	biological process
GO:0045409	negative regulation of interleukin-6 biosynthetic process	IDA	biological process
GO:0009725	response to hormone	IDA	biological process
GO:0050728	negative regulation of inflammatory response	IDA	biological process
GO:0042536	negative regulation of tumor necrosis factor biosynthetic process	IDA	biological process
GO:0045121	membrane raft	IDA	cellular component
GO:0032691	negative regulation of interleukin-1 beta production	IDA	biological process
GO:0008154	actin polymerization or depolymerization	IDA	biological process
GO:0043005	neuron projection	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway
hsa04935	Growth hormone synthesis, secretion and action

Diseases

Associated diseases	References
obesity	PMID:16511600
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881