• Gene id: 2686

Gene Summary

• Gene Symbol: GGT7   Gene   UCSC   Ensembl
• Aliases: D20S101, GGT4, GGTL3, GGTL5
• Gene name: gamma-glutamyltransferase 7
• Alternate names: glutathione hydrolase 7, GGT 7, gamma-glutamyltransferase 4, gamma-glutamyltransferase-like 3, gamma-glutamyltransferase-like 5, gamma-glutamyltranspeptidase 7, gamma-glutamyltranspeptidase-like 3,
• Gene location: 20q11.22 (34872857: 34844719)     Exons: 18     NC_000020.11
• Gene summary(Entrez): This gene is a member of a gene family that encodes enzymes involved in both the metabolism of glutathione and in the transpeptidation of amino acids. Changes in the activity of gamma-glutamyltransferase may signal preneoplastic or toxic conditions in the

Protein Summary

• Protein general information: Q9UJ14  
  • Name: Glutathione hydrolase 7 (EC 3.4.19.13) (Gamma glutamyltransferase 7) (GGT 7) (EC 2.3.2.2) (Gamma glutamyltransferase like 3) (Gamma glutamyltransferase like 5) (Gamma glutamyltranspeptidase 7) [Cleaved into: Glutathione hydrolase 7 heavy chain; Glutathion
  • Length: 662  
  • Mass: 70467
  • Tissue specificity: Widely expressed, but at low level, except in the airway epithelial cells. Detected in brain, heart, kidney, liver, lung, spleen, testis and trachea.
• Sequence:

  MAAENEASQESALGAYSPVDYMSITSFPRLPEDEPAPAAPLRGRKDEDAFLGDPDTDPDSFLKSARLQRLPSSSS
  EMGSQDGSPLRETRKDPFSAAAAECSCRQDGLTVIVTACLTFATGVTVALVMQIYFGDPQIFQQGAVVTDAARCT
  SLGIEVLSKQGSSVDAAVAAALCLGIVAPHSSGLGGGGVMLVHDIRRNESHLIDFRESAPGALREETLQRSWETK
  PGLLVGVPGMVKGLHEAHQLYGRLPWSQVLAFAAAVAQDGFNVTHDLARALAEQLPPNMSERFRETFLPSGRPPL
  PGSLLHRPDLAEVLDVLGTSGPAAFYAGGNLTLEMVAEAQHAGGVITEEDFSNYSALVEKPVCGVYRGHLVLSPP
  PPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIALALASRLGDPVYDSTITESMDDMLSKVEAAYLRGH
  INDSQAAPAPLLPVYELDGAPTAAQVLIMGPDDFIVAMVSSLNQPFGSGLITPSGILLNSQMLDFSWPNRTANHS
  APSLENSVQPGKRPLSFLLPTVVRPAEGLCGTYLALGANGAARGLSGLTQVLLNVLTLNRNLSDSLARGRLHPDL
  QSNLLQVDSEFTEEEIEFLEARGHHVEKVDVLSWVHGSRRTNNFIIAVKDPRSPDAAGATIL

• Structural information:
  • Interpro: IPR000101  IPR029055  
  • STRING: ENSP00000338964
• Other Databases: GeneCards:  GGT7  Malacards:  GGT7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1902883	negative regulation of response to oxidative stress	IBA	biological process
GO:0000048	peptidyltransferase activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0006751	glutathione catabolic process	IBA	biological process
GO:0036374	glutathione hydrolase activity	IBA	molecular function
GO:0006751	glutathione catabolic process	IEA	biological process
GO:0036374	glutathione hydrolase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0006750	glutathione biosynthetic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0102953	hypoglycin A gamma-glutamyl transpeptidase activity	IEA	molecular function
GO:0036374	glutathione hydrolase activity	IEA	molecular function
GO:0103068	leukotriene C4 gamma-glutamyl transferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0006749	glutathione metabolic process	IEA	biological process
GO:1901750	leukotriene D4 biosynthetic process	ISS	biological process
GO:1902883	negative regulation of response to oxidative stress	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00480	Glutathione metabolism
hsa00430	Taurine and hypotaurine metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R