• Gene id: 26716

Gene Summary

• Gene Symbol: OR2H1   Gene   UCSC   Ensembl
• Aliases: 6M1-16, HS6M1-16, OLFR42A-9004-14, OLFR42A-9004.14/9026.2, OR2H6, OR2H8, OR6-2, dJ994E9.4
• Gene name: olfactory receptor family 2 subfamily H member 1
• Alternate names: olfactory receptor 2H1, olfactory receptor 2H6, olfactory receptor 2H8, olfactory receptor 6-2, olfactory receptor OR6-32, olfactory receptor, family 2, subfamily H, member 6, olfactory receptor, family 2, subfamily H, member 8,
• Gene location: 6p22.1 (124973294: 124979388)     Exons: 3     NC_000008.11
• Gene summary(Entrez): Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing

Protein Summary

• Protein general information: Q9GZK4  
  • Name: Olfactory receptor 2H1 (Hs6M1 16) (OLFR42A 9004.14/9026.2) (Olfactory receptor 2H6) (Olfactory receptor 2H8) (Olfactory receptor 6 2) (OR6 2) (Olfactory receptor OR6 32)
  • Length: 316  
  • Mass: 35339
• Sequence:

  MVNQSSPMGFLLLGFSEHPALERTLFVVVFTSYLLTLVGNTLIILLSVLYPRLHSPMYFFLSDLSFLDLCFTTSC
  VPQMLVNLWGPKKTISFLGCSVQLFIFLSLGTTECILLTVMAFDRYVAVCQPLHYATIIHPRLCWQLASVAWVMS
  LVQSIVQTPSTLHLPFCPHQQIDDFLCEVPSLIRLSCGDTSYNEIQLAVSSVIFVVVPLSLILASYGATAQAVLR
  INSATAWRKAFGTCSSHLTVVTLFYSSVIAVYLQPKNPYAQGRGKFFGLFYAVGTPSLNPLVYTLRNKEIKRALR
  RLLGKERDSRESWRAA

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000725  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000366340
• Other Databases: GeneCards:  OR2H1  Malacards:  OR2H1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007608	sensory perception of smell	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04740	Olfactory transduction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)