• Gene id: 2671

Gene Summary

• Gene Symbol: GFER   Gene   UCSC   Ensembl
• Aliases: ALR, ERV1, HERV1, HPO, HPO1, HPO2, HSS
• Gene name: growth factor, augmenter of liver regeneration
• Alternate names: FAD-linked sulfhydryl oxidase ALR, ERV1 homolog, erv1-like growth factor, hepatic regenerative stimulation substance, hepatopoietin protein,
• Gene location: 16p13.3 (1984192: 1987748)     Exons: 3     NC_000016.10
• Gene summary(Entrez): The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (H
• OMIM: 600943

Protein Summary

• Protein general information: P55789  
  • Name: FAD linked sulfhydryl oxidase ALR (EC 1.8.3.2) (Augmenter of liver regeneration) (hERV1) (Hepatopoietin)
  • Length: 205  
  • Mass: 23449
  • Tissue specificity: Ubiquitously expressed. Highest expression in the testis and liver and low expression in the muscle. {ECO
• Sequence:

  MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQAPTSDSPVAEDASRRRPCRACV
  DFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLR
  KRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

• Structural information:
  • Protein Domains: (95..19-)
    oxidase (/note="ERV/ALR-sulfhydryl)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00654"-)
  • Interpro: IPR039799  IPR036774  IPR017905  
  • Prosite: PS51324
  • PDB: 3MBG 3O55 3TK0 3U2L 3U2M 3U5S 4LDK
  • PDBsum: 3MBG 3O55 3TK0 3U2L 3U2M 3U5S 4LDK
  • STRING: ENSP00000248114
• Other Databases: GeneCards:  GFER  Malacards:  GFER

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050660	flavin adenine dinucleotide binding	IBA	molecular function
GO:0015035	protein disulfide oxidoreductase activity	IBA	molecular function
GO:0016971	flavin-linked sulfhydryl oxidase activity	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0001889	liver development	IBA	biological process
GO:0050660	flavin adenine dinucleotide binding	IDA	molecular function
GO:0015035	protein disulfide oxidoreductase activity	IDA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016972	thiol oxidase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016971	flavin-linked sulfhydryl oxidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016972	thiol oxidase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Renal fibrosis	PMID:24844766
Kidney failure	PMID:18929838
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray