• Gene id: 266812

Gene Summary

• Gene Symbol: NAP1L5   Gene   UCSC   Ensembl
• Aliases: DRLM
• Gene name: nucleosome assembly protein 1 like 5
• Alternate names: nucleosome assembly protein 1-like 5, down-regulated in liver malignancy,
• Gene location: 4q21-q22 (88697828: 88695912)     Exons: 1     NC_000004.12
• Gene summary(Entrez): This gene encodes a protein that shares sequence similarity to nucleosome assembly factors, but may be localized to the cytoplasm rather than the nucleus. Expression of this gene is downregulated in hepatocellular carcinomas. This gene is located within a
• OMIM: 602428

Protein Summary

• Protein general information: Q96NT1  
  • Name: Nucleosome assembly protein 1 like 5 (Down regulated in liver malignancy)
  • Length: 182  
  • Mass: 19593
  • Tissue specificity: Predominantly expressed in brain. {ECO
• Sequence:

  MADSENQGPAEPSQAAAAAEAAAEEVMAEGGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFIESLPN
  SVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKIQELTGEMEGCAWTLEGEEEEEEEYEDDEEE
  GEDEEEEEAAAEAAAGAKHDDAHAEMPDDAKK

• Structural information:
  • Interpro: IPR037231  IPR002164  
  • STRING: ENSP00000320488
• Other Databases: GeneCards:  NAP1L5  Malacards:  NAP1L5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042393	histone binding	IBA	molecular function
GO:0003682	chromatin binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006334	nucleosome assembly	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray