• Gene id: 266747

Gene Summary

• Gene Symbol: RGL4   Gene   UCSC   Ensembl
• Aliases: Rgr
• Gene name: ral guanine nucleotide dissociation stimulator like 4
• Alternate names: ral-GDS-related protein, Ral-GDS related protein Rgr, RalGDS related oncogene, ralGDS-like 4,
• Gene location: 22q11.23 (42980515: 42995141)     Exons: 6     NC_000017.11
• Gene summary(Entrez): This oncogene encodes a protein similar to guanine nucleotide exchange factor Ral guanine dissociation stimulator. Increased expression of this gene leads to translocation of the encoded protein to the cell membrane. The encoded protein can activate sever
• OMIM: 612214

Protein Summary

• Protein general information: Q8IZJ4  
  • Name: Ral GDS related protein (hRGR) (Ral guanine nucleotide dissociation stimulator like 4) (RalGDS like 4)
  • Length: 473  
  • Mass: 52346
• Sequence:

  MRKLLTNLPAAAVLSAQVYSAVLQGLWEENVCGTPGRTRVCTALLYGQVCPFQDSTDGLRTITSILFNWPPENTS
  VYYQPPQRSSFRIKLAFRNLSWPGLGLEDHQEIVLGQLVLPEPNEAKPDDPAPRPGQHALTMPALEPAPPLLADL
  GPALEPESPAALGPPGYLHSAPGPAPAPGEGPPPGTVLEPQSAPESSCPCRGSVKNQPSEELPDMTTFPPRLLAE
  QLTLMDAELFKKVVLHECLGCIWGQGHLKGNEHMAPTVRATIAHFNRLTNCITTSCLGDHSMRARDRARVVEHWI
  KVARECLSLNNFSSVHVIVSALCSNPIGQLHKTWAGVSSKSMKELKELCKKDTAVKRDLLIKAGSFKVATQERNP
  QRVQMRLRRQKKGVVPFLGDFLTELQRLDSAIPDDLDGNTNKRSKEVRVLQEMQLLQVAAMNYRLRPLEKFVTYF
  TRMEQLSDKESYKLSCQLEPENP

• Structural information:
  • Protein Domains: (219..47-)
    (/note="Ras-GEF-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00168"-)
  • Interpro: IPR008937  IPR023578  IPR001895  IPR036964  
  • Prosite: PS50009
  • CDD: cd00155
  • STRING: ENSP00000290691
• Other Databases: GeneCards:  RGL4  Malacards:  RGL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq