• Gene id: 266722

Gene Summary

• Gene Symbol: HS6ST3   Gene   UCSC   Ensembl
• Aliases: HS6ST-3
• Gene name: heparan sulfate 6-O-sulfotransferase 3
• Alternate names: heparan-sulfate 6-O-sulfotransferase 3,
• Gene location: 13q32.1 (96090633: 96839561)     Exons: 4     NC_000013.11
• Gene summary(Entrez): Heparan sulfate (HS) sulfotransferases, such as HS6ST3, modify HS to generate structures required for interactions between HS and a variety of proteins. These interactions are implicated in proliferation and differentiation, adhesion, migration, inflammat
• OMIM: 609401

Protein Summary

• Protein general information: Q8IZP7  
  • Name: Heparan sulfate 6 O sulfotransferase 3 (HS6ST 3) (EC 2.8.2. )
  • Length: 471  
  • Mass: 54844
• Sequence:

  MDERFNKWLLTPVLTLLFVVIMYQYVSPSCTSSCTNFGEQPRAGEAGPPAVPGPARRAQAPPEEWERRPQLPPPP
  RGPPEGPRGAAAPEEEDEEPGDPREGEEEEEEDEPDPEAPENGSLPRFVPRFNFSLKDLTRFVDFNIKGRDVIVF
  LHIQKTGGTTFGRHLVKNIRLEQPCSCKAGQKKCTCHRPGKKETWLFSRFSTGWSCGLHADWTELTNCVPAIMEK
  KDCPRNHSHTRNFYYITMLRDPVSRYLSEWKHVQRGATWKTSLHMCDGRSPTPDELPTCYPGDDWSGVSLREFMD
  CTYNLANNRQVRMLADLSLVGCYNLTFMNESERNTILLQSAKNNLKNMAFFGLTEFQRKTQFLFERTFNLKFISP
  FTQFNITRASNVEINEGARQRIEDLNFLDMQLYEYAKDLFQQRYHHTKQLEHQRDRQKRREERRLQREHRDHQWP
  KEDGAAEGTVTEDYNSQVVRW

• Structural information:
  • Interpro: IPR010635  IPR027417  IPR005331  
  • STRING: ENSP00000365895
• Other Databases: GeneCards:  HS6ST3  Malacards:  HS6ST3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015015	heparan sulfate proteoglycan biosynthetic process, enzymatic modification	IBA	biological process
GO:0017095	heparan sulfate 6-O-sulfotransferase activity	IBA	molecular function
GO:0008146	sulfotransferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0017095	heparan sulfate 6-O-sulfotransferase activity	IEA	molecular function
GO:0015015	heparan sulfate proteoglycan biosynthetic process, enzymatic modification	IEA	biological process
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00534	Glycosaminoglycan biosynthesis - heparan sulfate / heparin

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq