• Gene id: 26664

Gene Summary

• Gene Symbol: OR7C1   Gene   UCSC   Ensembl
• Aliases: CIT-HSP-146E8, HSTPCR86P, OR19-5, OR7C4, TPCR86
• Gene name: olfactory receptor family 7 subfamily C member 1
• Alternate names: olfactory receptor 7C1, olfactory receptor 7C4, olfactory receptor OR19-16, olfactory receptor TPCR86, olfactory receptor, family 7, subfamily C, member 4,
• Gene location: 19p13.12 (14835184: 14798514)     Exons: 5     NC_000019.10
• Gene summary(Entrez): Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing
• OMIM: 606905

Protein Summary

• Protein general information: O76099  
  • Name: Olfactory receptor 7C1 (Olfactory receptor 7C4) (Olfactory receptor OR19 16) (Olfactory receptor TPCR86)
  • Length: 320  
  • Mass: 35519
• Sequence:

  METGNQTHAQEFLLLGFSATSEIQFILFGLFLSMYLVTFTGNLLIILAICSDSHLHTPMYFFLSNLSFADLCFTS
  TTVPKMLLNILTQNKFITYAGCLSQIFFFTSFGCLDNLLLTVMAYDRFVAVCHPLHYTVIMNPQLCGLLVLGSWC
  ISVMGSLLETLTVLRLSFCTEMEIPHFFCDLLEVLKLACSDTFINNVVIYFATGVLGVISFTGIFFSYYKIVFSI
  LRISSAGRKHKAFSTCGSHLSVVTLFYGTGFGVYLSSAATPSSRTSLVASVMYTMVTPMLNPFIYSLRNTDMKRA
  LGRLLSRATFFNGDITAGLS

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000725  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000248073
• Other Databases: GeneCards:  OR7C1  Malacards:  OR7C1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004984	olfactory receptor activity	IBA	molecular function
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007608	sensory perception of smell	IEA	biological process
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0007283	spermatogenesis	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04740	Olfactory transduction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray